KEGG   Candida orthopsilosis: CORT_0C05460Help
Entry
CORT_0C05460      CDS       T02488                                 

Definition
Eps1 protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cot  Candida orthopsilosis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cot00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CORT_0C05460
Enzymes [BR:cot01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CORT_0C05460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1252140..1254308)
Genome map
AA seq 722 aa AA seqDB search
MKLHGLSLLYLTASAVFANNVHKRSLDSPEAAAPPSNAEASSENIELPPTLGKEDFDAVT
SQKLTLVEFYSPYCSHCKSFFPTWQKAYRTFKTKFANLNTDMRQVNCVENGDLCEREQIE
FYPNILLYAPILDKDGKTTGKSKMIGSFPRTLEKNEANLISYIQESVADYDPASATMPSA
SKEMNVDEILKAISGEITKPLFISFWQANKKQWDSVDHGGKLRFSDDCIDCLRVKQLWDK
LSNKIVSLADSGHLLCQDYPKVCERLELDQLKDAKKSPPRFVMFLPKDRGTIRFDYDGPI
DVAKMKWWVNKLFVNSAYEVVSARGITEVMEFTKTLRHEPFAQNYPLKSKVTVVFFFDVD
NVTPEDEAILPYMLRTLQKSPFNIQLYKGKHKRILENIQTMGENLIPYINYDGSEKYEFN
EAMQIATSITEVPTIVVLKENCLIPEIYQNFALEQMRKYEEIEKFLERAQYPFIAELTPE
LVSVYFVDQDRAEDIKDAKVVIIFVDLDNLKATDEALYKLSLVAHEYNFLKKSYYFNQIL
EQRVSKEQEVEKLKAKNAETLTIMTTMRKQVPHLFNNDDVVFTFINKQTSKNFRYVRGWR
IRPDDYEVGDAVVVSKDHRYFWDTDLSNNKLRNEPKQIKSVLMSLLHKDNKVQLKFVGSP
YGGVLYFMNYVHDFGIVGYLGLIVVMYVLIYISMRLRRRRYRSPGIIGVNNGAFLPRKSN
KD
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcacggtctaagtttgctatatctcacagcgagtgcagtattcgcgaacaat
gtacataagcgatccctagattcacccgaggctgctgctcccccatccaacgcagaagcg
tcactggaaaacattgaacttcctccaacattggggaaagaagatttcgatgcagtcact
agtcaaaaactaacccttgttgagttctattcaccatattgcctgcattgtaaaagcttt
ttccccacatggcaaaaagcctataggacattcaaaaccaaatttgctaacttaaatacc
gatatgagacaggttaactgtgttgagaatggtgatttatgtgaacgtgaacagattgaa
ttctacccaaatattcttctatacgcaccaattttggataaagatggcaaaaccactggc
aaatcaaaaatgattggctcgtttccaagaactttggaaaaaaatgaagcaaacttgatt
agctatattcaagagtcggtagcagactatgatccggcatcagctactatgccatcagcg
tcaaaagagatgaatgttgacgaaatattgaaagccatcagtggagaaatcaccaagcct
ctctttatttcattttggcaagcaaataagaagcaatgggatagtgttgatcatggtggg
aaattgaggttcagcgacgactgtatcgattgtttacgcgtaaaacaattgtgggataaa
ttgagtaacaagattgtttcattagccgattcgggtcacttactatgccaagactacccc
aaagtctgtgaaagattggaattggatcagctcaaagatgcgaaaaagtcaccaccgaga
tttgtcatgtttttgccaaaagatagggggactataagattcgattatgatggtccaatt
gatgttgcaaagatgaaatggtgggtcaacaaactttttgtaaatagtgcatatgaagtt
gtatcagcaagaggaataaccgaagttatggaatttaccaaaaccttaagacatgaacca
tttgctcaaaattacccattgaagagtaaagttacagttgtttttttctttgatgtggat
aatgtaactcctgaagatgaggcaattttgccatacatgttgcgaacattacaaaagtca
ccatttaatatccagttatacaagggtaaacataaacgaattcttgaaaacattcaaacg
atgggtgaaaatttgattccatacatcaactatgacgggctggaaaagtatgagtttaat
gaagctatgcaaatagccacttctataactgaggttcctactatcgttgtattgaaggaa
aactgtttaattccagagatttatcaaaattttgctcttgagcaaatgaggaaatatgaa
gagattgaaaaattccttgaacgtgcacaatatccattcattgctgagttgactccagaa
ttagtatcggtatactttgttgaccaagatcgcgcggaagacattaaggatgcaaaagtg
gttataatctttgttgacttggataatttgaaagcgacggatgaagcgttgtacaagttg
tcattggtggctcacgaatacaactttcttaaaaagagctactacttcaaccaaatcctt
gagcaaagagtatcaaaagaacaggaagttgagaaattgaaagctaagaatgctgaaaca
ttaacaatcatgacaacaatgagaaaacaagtacctcacttgttcaacaatgatgatgtc
gtatttacatttatcaacaaacaaaccctgaaaaatttccgatatgtgagaggatggagg
attagacccgacgattatgaagttggtgatgcagtagtagtttcaaaagatcaccgatat
ttctgggatacagatttaagcaataacaaattaagaaatgaaccaaaacaaatcaaactg
gtgctaatgtctctattacacaaagataacaaagtgcagttgaaatttgttggttctcca
tatggtggagtattatatttcatgaactatgttcatgattttggaattgttggatattta
ggactcattgttgttatgtatgtgttgatttatatatcaatgagattgaggagacgcagg
tatagatcgccaggtataattggtgtcaataatggcgcatttttacctaggaagctgaat
aaggactag

DBGET integrated database retrieval system