KEGG   Candida orthopsilosis: CORT_0C05980Help
Entry
CORT_0C05980      CDS       T02488                                 

Definition
(RefSeq) Ole2 protein
Organism
cot  Candida orthopsilosis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1356023..1357645)
Genome map
AA seq 540 aa AA seqDB search
MDEKPRNGQSIKIQRRKVVFSTNSTSSASQSLINQATKMKNTRIKEIRKRRRDLFMRINY
THTITTVVLPLLMLGYMLYFKESILPENQSTLYFTIVYYNITMLAFTAGYHKYFAHNSYK
IKFTLLKYYFAIFGSSCGLGSIRWWASLHRAHHHFPNDTERDPYSIKRGLLFSHYGWLLK
KPRAVKFYNEFIEQEFPQNIDEARLSQDIKLDKEQREAFGLRDEFDNDSGDEEEEIEFKD
SYDENMRNLLNWQERTYIIWFAVTTIFIPILVTRLFCHDTTIHGLIYPGIFRMFLCQQSL
LTTESLCHLKQIQVTIPSQPFSDKNSSQDCQNPLMALLTYGQSHQNYHHEFPHDYRSNNA
YLTYDPTKWFIWTLDKLGIVCELCRTPDNLVEHLRLQQQQERLNRIRSQLNWGTPISKLP
LITPQDFKRTIESSSNKDRIYIVIQNIIHDITPFMDQHPGGVQLLKASHGKDATRAFYGG
VYGHSTAAINLLATMRIGILDNGNDEEVWTRVVKEEGEVREVSESRQGGGSNEYRTAEAA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaaaccacgcaatggccaaagcatcaagatacaacgaaggaaagtggttttc
tccaccaactccacctcatctgcatcgcaaagtcttattaatcaagcaacaaagatgaaa
aacacaaggatcaaagaaatcagaaagcgtaggagagatttgtttatgagaataaattat
actcataccatcactacggtagttttaccacttttaatgctaggttatatgctatatttt
aaagaaagtatactacctgagaaccaaagtactttatatttcaccattgtatactacaat
atcaccatgttggcattcactgccggctatcataagtatttcgctcataactcatacaag
atcaagttcaccttgttgaagtattattttgccatttttggtagtagttgtggtttgggc
tcaattagatggtgggcttccttacatcgagcacatcatcatttcccaaatgataccgaa
cgagatccatatctgatcaagcggggtttgttatttagccattatggatggttgttgaag
aaaccgagggcagttaaattttataatgaatttattgaacaagaatttcctcaaaacatt
gatgaggctagactttcgcaggacataaaacttgataaagagcagagagaagcgtttggg
cttcgagatgaattcgataatgatagtggggatgaagaggaagaaattgagtttaaggac
tcttatgatgagaatatgaggaatttattaaattggcaagaaaggacatatataatatgg
tttgcagttaccactatctttatcccaattttggtgactaggctattctgccatgataca
acaatacacggattaatatacccgggcatatttcgaatgtttttatgtcaacaatcactc
ctcacaactgaatcgttatgtcatttgaagcaaatacaagttacgatcccatcacaacca
ttcagtgataaaaactcttcccaagattgtcaaaacccattaatggcattactcacctat
ggtcaatcacatcagaattatcatcatgaattcccacatgattatcggagcaacaatgct
tatctcacttacgatccgacaaaatggtttatttggacgttggataaattggggatagtt
tgtgaattatgtcgaacaccagataatttggttgaacatttacgacttcaacaacaacaa
gaaagacttaatcgcatacgaagtcaattgaattggggtacaccaatatccaaactacct
ctaataacacctcaagattttaaacgcaccatagagtcatcctcaaataaagaccgtatt
tatatcgttattcaaaatatcattcatgatatcacaccattcatggatcaacatccaggt
ggggttcaattgttgaaagcatcacatggtaaagatgccactagagcattttatggtggc
gtttatggacatctgacggcagcaattaatttattggccactatgagaataggaatattg
gataatgggaacgatgaagaagtttggactagagtggttaaagaagaaggtgaagttagg
gaagtttcagaatcacgacaaggtggtggttcaaatgagtatcgtactgctgaagctgca
taa

DBGET integrated database retrieval system