KEGG   Candida orthopsilosis: CORT_0D01390Help
Entry
CORT_0D01390      CDS       T02488                                 

Definition
Rbk1 protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cot  Candida orthopsilosis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CORT_0D01390
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CORT_0D01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(234199..235131)
Genome map
AA seq 310 aa AA seqDB search
MTPTITVIGSLNYDLVTFTNKVPEGGETYQANSFEMHMGGKGLNEAIAVARLSPDGKVNT
RMVGKVGTDQFGASLKQCLVDSGVDVSNVKTVDGSSGVAVIIVEESGENRILITSGANGE
LKLSDEEYASIFKDDSFVVLQNEYPDTAKSITWLKKNRPDINIAYNPSPYKPELITNEIL
SKIDLLIVNEGEAQDVARHLLGGTVTSFDMLAVEIQKLLHQGNVKTVVITMGSEGSIFYN
GESEPTFIPAKKVDSVVDTTGAGDTFFGALVSNLALGQNLEEAVNFATKASSLAIQKTGA
AESIPFYKDV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgacaattacagttatagggtccctcaattacgacttggttacgttcaccaac
aaggtgccagaaggtggcgagacctaccaggccaattcatttgaaatgcatatgggtggc
aaaggtttgaacgaagcaattgctgtggcaagattatcaccagacggtaaggttaacaca
agaatggttggcaaggtgggaacagaccaatttggagcgagcttgaagcagtgtcttgtt
gattccggagttgatgtgtcaaacgtgaaaacagttgatgggtcttcgggagtggctgtc
attattgtcgaggagagtggtgaaaatcgaattttaatcacactgggggcaaatggggaa
ttgaagttgtctgatgaggaatatgcatccatcttcaaagatgactcgtttgttgtgttg
cagaatgagtatcccgatactgccaagagcatcacttggctaaagaaaaacaggccagat
attaatattgcatacaatccttccccatacaagccagagttgattacgaatgaaatatta
tccaagatagaccttttgattgtcaatgagggagaggcgcaagacgtcgcaaggcatctc
ttgggaggcactgtgacgctgtttgacatgttggcagtggaaattcaaaagcttcttcat
caagggaatgtcaaaacggttgttatcaccatgggcagcgagggaagtatcttttacaac
ggggaaagcgaacctacatttatccccgccaaaaaggttgattccgttgttgacacaact
ggcgcaggtgatacattttttggtgcgcttgtttctaatttagcattagggcagaatctt
gaagaggctgttaatttcgctactaaagctagcagcttggcaattcaaaagacaggagct
gcagagagtataccattttataaagatgtctaa

DBGET integrated database retrieval system