KEGG   Candida orthopsilosis: CORT_0D04900Help
Entry
CORT_0D04900      CDS       T02488                                 

Definition
Gcn5 histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CORT_0D04900
Transcription machinery [BR:cot03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CORT_0D04900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:959535..960935
Genome map
AA seq 466 aa AA seqDB search
MVDRKRTIRVEDDEDEDDVPLNKKMKLESKENTPLVKEEEEEVSGVKTENLSVKEDVKEE
PMEEVNGEQANNEEANDEDDDDDDDDDDGEDEEAEEEQKRITNFNFDGEIYTFKERPSVI
EEKEGKIEFRVVNNDNTKDSLIVLTGLKNIFQKQLPKMPREYISRLVYDRSHLSMAVVRK
PLTVVGGITYRPFNNREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRATSPIKYFLTYA
DNYAIGYFKKQGFTKEITLDKSVWMGYIKDYEGGTLMQCSMLPSILRYLDSGKILLLQKA
AIERKIRSRSKSNVVRPGLQIFKTNKNVTLDYKDIPGLAEAGWSEEMDKLAQKPKRGPHY
NFMVTLFSEMQNHPSAWPFAVPVNKDEVPDYYDVIKEPMDLSTMEQKLENDKYESFEQFL
YDARLIFKNCRSYNSESTTYYKNANKLEKFMNNKIKDSAEYSHFLE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggttgacaggaagagaacaatacgagtggaagacgatgaggatgaggatgatgttcca
ttgaataaaaagatgaaattggaatcaaaagaaaacacacctctagtgaaagaggaagag
gaagaagtgtcgggagttaaaacagagaatctctcagtaaaagaggatgtaaaagaagag
ccaatggaagaggtaaacggagaacaggcaaacaatgaagaagcaaatgatgaagatgac
gacgatgacgatgacgacgatgatggcgaagacgaggaggcagaggaagaacaaaaacga
ataaccaacttcaatttcgatggagaaatatacaccttcaaagagcgaccttcagtgata
gaggaaaaagaaggcaagatcgaattcagagtggtaaataatgataacacaaaggatagt
ctaatagtcttaactggtctcaaaaacatttttcaaaagcagttgccaaaaatgccgcgt
gagtatatatcgcgattggtctatgatcgctcacatttatcaatggctgttgtacggaaa
ccgttaactgtggttggtgggataacctatagacccttcaacaatagagaatttgcagaa
attgtgttttgtgctatttcctcgaccgaacaggtacgtgggtacggtgcccatttgatg
aatcatttgaaagattacgttagagcgacttccccgattaaatactttctaacttatgca
gataactatgctattggttacttcaagaagcaagggttcactaaagaaataacgcttgat
aaatcggtgtggatggggtatataaaggattacgaaggtggtaccttgatgcagtgctcg
atgctcccgtctattctcagatatcttgacctgggaaagatacttcttctacagaaagca
gcaatcgagaggaagataagactgcggtcgaaatctaatgttgtccgacctggtcttcaa
atttttaaaacgaataaaaacgtgactctcgattataaggatatacccgggttggccgaa
gcagggtggctggaagagatggataaattggcacagaaaccaaaaaggggtcctcattat
aatttcatggtcactcttttttcagagatgcaaaaccacccttcagcatggccattcgca
gtacccgtcaacaaggatgaagtccctgattactacgacgtcatcaaagagcctatggat
ttgtctacaatggaacagaaattggaaaatgataaatatgaatcatttgaacagttcttg
tacgatgccaggttgattttcaaaaattgtcggtcgtataatagtgagtccactacgtat
tacaaaaatgccaataaattggaaaagtttatgaataacaagattaaggacagtgccgaa
tattctcatttcttagaataa

DBGET integrated database retrieval system