KEGG   Candida orthopsilosis: CORT_0D05290Help
Entry
CORT_0D05290      CDS       T02488                                 

Definition
Cek2 MAP kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CORT_0D05290
Protein kinases [BR:cot01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CORT_0D05290
Exosome [BR:cot04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CORT_0D05290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1051433..1052596)
Genome map
AA seq 387 aa AA seqDB search
MSIIPVKTKDSFDKMVKAQPPESSGKVVFNISQNFKVLKIIGEGAYGIVAMAVHLPTNTK
VAIKMIEPFERPLFCLRTLREIKFLQKFNSHENIIKLYDVQRPTNFSSFNEVYLIQEYMP
EDLNQIIQTHALSDQHVQFFMYQILKALKLIHSANVIHRDLKPSNILVNENCDLKLCDFG
LARLDSVGILTNKISLLTEYVATRWYRAPEIMLNASHYSTAIDMWSVGCILLELLIYKVV
FPGSDYINQLILIFELLGTPSEKDLEVVKSKRAKVFIKSLPVRSKINFYNFCTNHPCRRI
RHQNRDLEVNPLAIDLLEKLMVFDPSKRLTAKEALKHPYMSNYHDPLDEPVTSPIPMEEF
AFDIEKKYLNVDDLKRLIYDQIMPSKR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtataattccagtcaaaactaaagactcattcgataagatggtgaaggcacagcct
ccagagtctctgggcaaagttgtgttcaatatatcacaaaatttcaaagtcctcaagatc
attggagagggagcttatgggatagttgcgatggccgttcatttacccacaaataccaaa
gtagcaataaaaatgattgaaccatttgaaagaccactattttgcttgagaacacttcgt
gagattaagtttttgcaaaagttcaactctcatgaaaacattattaagttatatgatgtt
caaagaccaacaaactttagttcatttaatgaggtgtatttgatacaagagtatatgcca
gaagatttgaaccaaattattcaaactcatgcattaagcgatcagcacgtgcaatttttc
atgtaccagatactaaaagctttgaagttgatccacagtgccaatgtaattcatcgagac
ttgaaaccatcaaacattttggtcaatgaaaattgtgatttaaaactttgtgattttgga
ttagcaagacttgattcagttggtatactaacgaacaagatttcgttgttgacagaatat
gtagctactagatggtacagagcaccagaaattatgctcaatgcatcacactattcaaca
gctattgatatgtggtcagttgggtgcatattgcttgagttgttgatctataaggtagtt
tttccaggttcggactacattaaccaattgatcttaatatttgaattattgggaacacca
tcggagaaggacttggaagttgttaaatccaagagagccaaggtattcatcaagtcacta
ccagtacgttcaaaaatcaacttctacaacttttgtaccaatcatccatgcaggcggatt
agacatcaaaatcgcgacttggaagtgaacccacttgctatagacttgttggaaaaattg
atggtgtttgatcctagtaaacggttaacagcaaaagaagctttgaaacacccttacatg
agtaactatcacgacccattagatgaaccagttacctcgcctatcccaatggaggagttt
gcatttgacatagagaaaaagtatttgaatgtagatgacctcaagagattgatttatgat
caaatcatgccaagcaaaagatga

DBGET integrated database retrieval system