KEGG   Candida orthopsilosis: CORT_0D06490Help
Entry
CORT_0D06490      CDS       T02488                                 

Definition
Hos2 histone deacetylase
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
cot  Candida orthopsilosis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1334478..1335722
Genome map
AA seq 414 aa AA seqDB search
MDASTSETETFTVDEQTKKHVPLYHPNKSSKTKVSYHYNPEVANYHYGTLHPMKPFRLML
TDHLVSTYKLHEKMDLYTPRKATQEELLQFHSEDYIDFLQSVTPETVKTLSDQTLAKFNI
GDDCPVFDGMFDYSSIYAGASLDASRKILAGMADIAINWSGGLHHAKKFEPSGFCYINDI
VLCIINLLRIHPRVLYVDIDLHHGDGVQEAFYTTDRVMTVSFHKYDGEFFPGTGSGDEAG
IGKGKNFAINVPLRDGIDDESYVALFKSIMQVVMPKFQPSIIVAQCGADSLGGDRLGRFN
LSLKGHGNCLNFLKSFGIPMVVLGGGGYTPKNVSRLWCYETAVLTDTTLNGKIPNYGGTS
QWFGDEGLHPELTGKIENKNTKRYLESVLQNSLEHLRYLDYAPSVQMYEIPPEL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggatgcctctacaagtgagacggagacgttcaccgtcgacgaacagaccaaaaagcac
gttccactataccaccccaataaatcctccaagaccaaagtttcttaccactacaatcca
gaagtggcaaactaccactacggcactttacacccaatgaagcctttccgactaatgtta
actgatcacttggtgagtacgtacaagcttcatgaaaaaatggacttgtacacgccaagg
aaagctacacaggaagagttgttgcaattccattctgaagattacatcgactttcttcag
tcagtgactccagaaacggtgaaaacattaagtgatcaaacattggcaaaattcaatata
ggtgacgattgtcctgtttttgacggaatgtttgattactcgtccatttatgctggggca
tctttagatgcatcgaggaaaattcttgcaggcatggccgacatcgcaataaattggtct
ggaggactacatcacgccaaaaagtttgaaccaagcggattctgctacataaatgatata
gtcttgtgcatcataaatctattgagaatacatccaagagtattgtacgtagatatcgat
ttacatcatggggatggagtccaagaggcattttacacaaccgatagagtaatgacggtt
agtttccacaaatatgatggtgaatttttccctgggactggttcaggtgatgaagctggt
ataggcaaaggtaagaattttgccattaatgtgccattgagagatgggattgatgatgaa
tcgtatgtggcattgtttaagctgattatgcaagttgtgatgcccaagttccaaccttct
atcattgttgcacaatgtggtgcagattccttaggtggtgaccgtttagggagatttaac
ttgtccttgaaaggacatggtaattgtttaaattttctcaagagctttggaataccgatg
gtggttttgggaggtggaggatatacacccaaaaacgtttcaagattgtggtgttacgag
acggcggttttaactgacacaacattgaatgggaaaattccaaactacgggggtacttct
caatggtttggtgacgagggacttcatcccgagttaacggggaagattgaaaacaaaaac
acaaagaggtatttggaaagtgtactacagaacagcctcgagcatcttagatacttggac
tatgctccatctgttcaaatgtatgaaatacctcccgagctctaa

DBGET integrated database retrieval system