KEGG   Candida orthopsilosis: CORT_0D06880Help
Entry
CORT_0D06880      CDS       T02488                                 

Definition
Esa1 subunit of the NuA4 histone acetyltransferase complex
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CORT_0D06880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1424595..1426118)
Genome map
AA seq 507 aa AA seqDB search
MPSTETKPDPSSNGDQEPISNTPIQIKTEDGANGNNEDFFTVDNILPGCKVYATKDGEER
LAEILQEHMKKGRKVFYVHYQDFNKRLDEWIEIDRINFKRPLILPEVKVDEKKESKQKKK
TKSKASKSQAGTSASTPREETPQMNDDEMDLENLNVQGLKRPGEEVSREEEIKKLRSGGS
MTQNHSEVARVRNLSTVILGEHIIEPWYFSPYPIELTEEDAIYVCDFTLSYFGSKKQFER
FRSKCSMKHPPGNEIYRDSKVSFWEIDGRKQRTWCRNLCLLCKLFLDHKTLYYDVDPFLF
YVMTIKSEQGHHVVGFFSKEKESADGYNVACILTLPCYQKRGFGKLLIQFSYMLSAVEKK
VGSPEKPLSDLGLLSYRAYWTDTLIKLLVERNNPTLFKKNNSHPADEDDYEGSPPPSRNG
NSTNEITIEDISAITCMTTTDILHTLTTLKMLRYYKGQHIIVLTDQIMAMYDKLVKKVKE
KKKHELNPKLLNWTPPSFTASQLRFGW
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgccaagtacggagactaagcccgatccttcatccaacggcgaccaggagcccatttct
aacactcctatacaaatcaaaactgaggatggtgcgaatggaaacaatgaagatttcttc
acagttgataatatcttacctggttgtaaagtatatgctaccaaagatggagaagaaaga
ttagcagagatcttgcaagagcatatgaaaaagggtagaaaagttttttacgtccattac
caagatttcaataaacgtttagatgaatggattgaaattgaccgaataaattttaagaga
cccttgattttacctgaagtcaaagttgatgagaagaaagaaagtaagcaaaagaagaag
acaaaactgaaagcttcaaaatcacaagctggcactagtgcttctacaccacgagaagaa
acaccacaaatgaatgatgatgaaatggatttagaaaatcttaatgtgcaggggttgaaa
agaccaggagaagaagtaagtcgagaagaagaaatcaaaaagctccgatcaggtgggtcc
atgactcaaaatcattctgaggtggctagggttagaaatttatcaactgtgattcttggt
gaacatataatagaaccgtggtatttctcgccataccccattgaattaactgaagaagat
gcaatatatgtttgtgatttcacattatcttattttggctccaaaaagcaatttgaaaga
tttagatcaaaatgttcaatgaaacatccaccaggtaatgaaatatatcgtgattcaaaa
gtaagcttttgggaaattgatggcaggaaacaaaggacctggtgtcgaaacctttgttta
ctttgtaagctctttttggatcacaagacgttgtactatgatgttgacccctttttgttt
tatgtcatgactataaaatcagagcaagggcatcatgttgtcgggtttttctccaaggaa
aaagaaagtgccgatgggtataatgtggcgtgtatcttgactctcccttgttatcaaaag
agaggatttggtaaattattgatacaattttcttacatgttatcagcagtggaaaagaaa
gtgggatcacccgagaagccattgtctgatttgggacttttatcttatagagcttattgg
actgatacattgattaaactattggttgaacgaaacaatccgaccctattcaaaaaaaac
aattcacacccagctgatgaagatgattatgaaggttcgccaccaccatcacgaaatggg
aactccactaatgagatcactattgaagatatatctgcaattacatgcatgacaacaaca
gatatactacatacattaacgacattgaaaatgctacggtattacaaaggtcaacatatc
attgtcttgactgatcaaattatggccatgtatgataaactagttaaaaaagtgaaggag
aagaagaaacatgaattgaacccaaaacttctaaattggaccccaccactgttcacagca
agtcaattacgatttggatggtaa

DBGET integrated database retrieval system