KEGG   Candida orthopsilosis: CORT_0E01700Help
Entry
CORT_0E01700      CDS       T02488                                 

Definition
Hos3 histone deacetylase
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CORT_0E01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:365367..367544
Genome map
AA seq 725 aa AA seqDB search
MTTRDNISHHHRNDSEDSLIEAFETTLTIKPSTTEYEDNDISIDHTVLPNSTVNYTRDAT
SMVDIEELEENEQLEEQIPKFKTNRRYSLLPTKTTFKKIGSPGLEEYYVQQKLDPKFHDI
LKPSVLIDEKLIKYHHTFSDFIASNPHINKESPRFQHNSEKTLVILSPYSPEHAFGRKWV
TKSYLSTIFERPQRLLASCIGVASAITMYPFYYKLINSTKRSSIFASHVRKIHGKNWPKK
LFELCLESHEKLNNDEIEVPEDWNTGDIYLTPKTINAIEGVIGTIETAVDSLFNTSSTSP
QAGISTSGRGNHDLAFVVIRPPGHHSHACLPSGFCLLNNVQIGIEYAFETYGVTHCAILD
IDLHHGDGSQDICWERAGFTGDYGQQAEDEIDDPSLNPRNEYGKRFATFPKVGYFSLHDI
KSYPTELGFATKENIKNASTCIMDHDLNIWNVHLQNWNTEDEFYKHYQTRYVAILNRANQ
FLNNAKKQHDQEYEEYLAQLSKYNKYLQKPHLYPNQKPEKPTPPPAYKPLIIISAGFDAS
EYEDPQMQRHGINVPTSFYATFTKDVVKLAKIHTKGKVISFLEGGYSDGALTTGIFSHLI
GLNNDDDLLWNHTWGSEQVAKELIKGCKKNWTPYKNPKSEITIWANEVIKLGRSMMPNAI
LPANHIYRDQSKDKDVVNGKPVNRMVKDLLDGGVGIIETPKMKKIDDREDFKKPVRHTRS
YYKTV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcgagataatatctcccatcatcatcgaaatgatagtgaggattcattgatt
gaggcatttgaaactactttgactattaaacccagcaccactgaatatgaagataacgac
atatccatcgaccatactgttttgcccaattcgacagtaaattacactcgagatgcaacc
agtatggttgatattgaagagttggaagaaaatgaacaactagaagagcaaatacccaaa
ttcaaaactaatagaaggtatagcttacttccaacaaagactacgtttaagaaaattgga
tcacctggattagaagagtactatgttcaacaaaaacttgaccccaaatttcacgacatc
ctaaagcctagtgtacttattgatgaaaaattgattaaatatcaccacacatttagtgat
ttcattgcatcaaacccacacattaataaggagtcacctcgattccaacataattcagaa
aaaacattggttatattatcaccatatagtcctgaacatgcatttggtaggaaatgggtg
acaaagtcatacttgtcgacgatttttgaacgtccacaacgattacttgcaagttgcatt
ggtgttgcttcagcaatcacaatgtatcctttttactacaagcttattaattcaacaaag
agaagttccatctttgcatcacatgtaaggaaaattcatgggaaaaattggccaaaaaag
ttatttgaattgtgtttggaaagtcatgaaaagttgaataatgatgaaattgaggttccc
gaggattggaacactggtgatatttatctcacaccaaagaccataaatgcgatcgagggt
gtaattggtacaatagaaactgctgtcgatagtttgttcaacactctgtcaacatctcct
caagcaggtattagcacttccggtagaggaaaccacgacttggcgttcgtagtgatacga
ccaccaggccaccacagccacgcttgcctacctagtggcttctgtttattaaacaatgta
caaattgggatagaatatgcatttgaaacatatggtgtgacacattgtgctatattagat
attgacttgcatcatggggatggctcacaagacatttgctgggaaagagctggttttaca
ggagattatggccaacaagccgaagatgaaattgatgacccatcattgaatccgcgtaat
gaatatggtaaaaggtttgcaacgtttcccaaggtggggtatttttcacttcacgatata
aaatcgtaccctactgaattgggatttgcaacaaaggagaatatcaagaatgcgtcaacc
tgtataatggatcatgacttgaatatttggaatgtccatttacaaaattggaatactgaa
gatgaattttacaaacattatcaaactagatacgtggcgattctaaaccgtgcaaatcaa
ttcttaaacaatgccaagaagcaacacgatcaagagtatgaggagtatttagctcaattg
agcaaatacaacaagtatctacaaaaaccacacctttatccaaaccagaaaccagagaag
ccaacaccaccaccagcatacaaacctttaatcataatatctgctggattcgatgcttct
gaatacgaagacccacaaatgcagcgacacggtataaacgttccaacttcattttatgca
acattcaccaaagatgtggtaaaattggccaagatacacactaaagggaaagtcatttca
tttcttgaaggtggttatagtgatggcgctttaacaacaggtatattttcccatcttatt
ggattaaacaatgatgatgatctcttgtggaatcatacatgggggtcagaacaagttgct
aaggaattgattaaaggatgcaaaaaaaactggacaccttataaaaaccccaagagtgaa
atcaccatttgggctaatgaggttatcaagttaggacgttcgatgatgcccaatgccatt
ttacccgcgaaccacatttatagagatcagtcaaaggataaagacgtcgtcaatgggaaa
ccagtaaatcgaatggtgaaggatcttttagatggtggagtggggataatcgagacacct
aaaatgaaaaaaatcgatgatcgtgaggactttaaaaagccagttagacatactagatct
tactataaaacagtctga

DBGET integrated database retrieval system