KEGG   Candida orthopsilosis: CORT_0E02770Help
Entry
CORT_0E02770      CDS       T02488                                 

Definition
His4 protein
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
cot  Candida orthopsilosis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cot01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cot00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:588527..591070
Genome map
AA seq 847 aa AA seqDB search
MTFPILPFLSSPEDPQFDNLSITGQVLFPYDSLKLSKHWIQQFPSQLAIFVQVDKDITVD
QITELLNLGVERVFLFDESQYESVLSAGLPEDRFAGPVLQSNSSLIVSEKLGDLKKYNND
ENRDVYFDLTGGNISQDEVDELAKLGYTIILPSNTLVTKKQEPGKVSISSTFVNTLVTDR
QDGLFTTLITSPAPQYTALGIVYSSKESIIAAIDEKVGVYQSRKRTHELWYKGKTSGATQ
KLLQVSKDCDSDVVKFMVENRKGYGFCHKASKYTCFGDNLQSNGHGLSKLDATLQDRFEN
APEGSYTKRLFNDESLLIAKLKEELDELIDAKDNQDEVAWEAADLLYFVMCWCIKNGVRL
SDVEKNLDIKSLKVTRRKGDAKPAYLEKKEKNGPEQKKPKTQEDADYQLEVIDASDLSSP
GIAKAMTRPAQKTSEIMKLVLPIIENVKSNGDKALLELTAKFDGVTLDTPVLKAPFPESL
MNISQEMKNAIDLSMSNIEKFHAAQLPKEAVMTVETAPGVYCSRFAKPIENVGLYVPGGT
AVLPSTAMMLGVPAKVAGCKNIVIASPPSRSTGQLTPEVVYVAHKLGASCIVMAGGAQAI
TALAYGTESVIKCDKILGPGNQFVTAAKMYIQNDTQALCSIDMPAGPSEVLVIADENADA
DFVASDLLSQAEHGVDSQVILIGVGLSAAKLQEFQQAVTKQASALPRKEIVAKCLSHSYI
LLTKSYQDAFDLSNQYAPEHLILQINNAASYVPDYIENAGSVFVGALSPESCGDYSSGTN
HTLPTYGYARQYSGVNTATFQKFITSQDVTKQGLQSIGKAVMTLAAVEGLEAHRRAVEVR
MEKLGLL
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttcctatattaccattcctttcatctcccgaagatccacaatttgataacttg
agcatcacaggacaagttttgtttccatatgactcactcaaattgagtaaacactggata
caacaatttccatcacaattggccatattcgtacaagttgataaggatattactgtggac
caaattaccgaattattgaacctaggcgttgagagagtattcttgtttgatgagtcacag
tatgagtcagttttaagtgctggattgcctgaagatagatttgcaggccctgtattgcaa
tctaatctgtcattaattgttagtgaaaaattgggtgatttaaaaaaatacaacaatgat
gagaacagagatgtatatttcgatttgactggaggtaatatatctcaagatgaagttgat
gaattagctaaattgggatacaccatcatactaccatcaaacaccctagtcacaaagaaa
caagaacctggtaaagtatcaatttcttccacatttgttaatactttggtcactgataga
caagatgggttattcaccacattaatcacatctccagcaccacaatacacagcattaggt
attgtctattcttcaaaagaatccataattgctgccattgatgaaaaagttggagtatat
caatcaagaaagaggacccatgagttatggtacaagggcaaaactagtggtgctactcaa
aagcttcttcaagtttccaaagattgtgattccgatgttgttaaattcatggtggaaaat
cgtaaaggatatggattttgtcataaagctagtaagtatacttgttttggtgacaattta
caatctaatggacatgggttatcgaaattggatgctactctacaagatagatttgaaaat
gctcctgaaggatcatacaccaaaagattgtttaatgacgaatcgttacttattgctaaa
ttgaaagaagaattggatgaattgattgatgcaaaggataatcaagatgaagttgcttgg
gaagcggctgatttattatacttcgtcatgtgttggtgtattaaaaatggagttagatta
agtgacgttgaaaagaatcttgacatcaagtcgttgaaagtgacaagaagaaaaggtgat
gctaagccagcatatttggaaaagaaagagaagaatgggccagaacaaaagaagccaaag
actcaagaagatgcagattatcaattggaggttattgatgctagcgatttatcttctcca
ggtattgctaaagccatgaccagaccagcccaaaagacatctgaaattatgaaattagtg
ttgccaattattgaaaatgtaaagtccaacggagataaagcattgttggaattgacagca
aaatttgatggtgttacattagacacaccagtactcaaagcaccattccctgaatcactc
atgaacatctctcaagaaatgaagaatgctattgatttatcaatgtccaatattgaaaaa
ttccatgctgctcaattaccaaaagaggcagtcatgacagttgaaacagcacccggtgtc
tattgttccagatttgccaagccaattgaaaatgtcggactttatgtacctggaggtact
gccgtcttgccctcaacggcaatgatgttgggtgtgccagcaaaagtagctggttgtaaa
aacattgttattgcttcgccaccgtcaagaagcacgggtcaattaacacccgaggtggtg
tatgttgctcataaactaggtgcttcatgtattgttatggctggcggtgcacaagctata
acagcattggcttatggtaccgaatcagttataaaatgtgacaagattttgggtcctggt
aatcaatttgttactgctgccaagatgtatattcaaaatgatacacaagccttgtgttca
attgacatgcctgcgggaccaagtgaagtattggtgattgctgatgaaaatgccgatgct
gattttgtagctagtgatttattatcacaagctgaacacggggttgattcccaggtcata
ttaataggagttggtttatctgctgccaagttgcaagaatttcaacaagcagtgacaaaa
caagcttcagccctaccaagaaaagaaattgttgccaaatgtttatctcattcatacatt
ttacttaccaaatcatatcaagatgcatttgacttatccaatcaatacgcaccagaacat
ttgattttacaaatcaacaatgctgcctcgtatgttcccgactacattgaaaatgccggt
tcagtgtttgttggtgcattatcaccagaatcttgtggtgattattcaagtggtactaat
catacattgcccacttatggttacgctagacaatactctggtgtcaatacggcaactttt
cagaaattcatcacttctcaagacgttactaaacaagggttgcaaagtattggtaaagca
gttatgactttggctgcagttgaaggattggaagctcatagaagagcagttgaagttaga
atggaaaaattgggactactttga

DBGET integrated database retrieval system