KEGG   Candida orthopsilosis: CORT_0E04050Help
Entry
CORT_0E04050      CDS       T02488                                 

Definition
Ncp1 NADPH-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cot  Candida orthopsilosis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:895712..897757
Genome map
AA seq 681 aa AA seqDB search
MALDRLDLTVVIVLAVAVTVYFLKSQFFTKPESSGFLHTDTAGGNSRDILATLSKNNKNT
LLLFGSQTGTAEDYCNKMSRELSARFGLKTMVADFADYDWDNFGDIKDETLVFFIMATYG
EGEPTDNAIEFIDFLDNEADTLSALRYTVFGLGNSTYEFFNAIGRKIDQKLEEKGAERFA
EYGEGDDGQGTMDEDFLAWKDGVFDSLRNNLDLEEKELKYEPSLKLEVRDDLTIDDPSVS
LGEPDKSYVNTKAGTDLSKGPFDHSHPYLAPITKVKELFFTKERSCVHVEFDLSNSNLKY
TTGDHLAIWPSNANEYVELFLKAFDLTEQRDTVFDLKALDSTYQIPFPTPITYEAVIRHH
LEISGPVSRQFFLSIAAFAPDEETKTRLTTVANDKQKYAEEITHKKFNIADGLLHLSNGK
PWTKVPFEFLIENVQHFTPRYYSISSSSLSEKTHIDITAVVESEAESDGRVVTGVVTNLL
KNIEINKNSSSDKPIVSYDLKGPRNKFQNYKLPIHVRRSTFKLPSSSKTPIILVGPGTGV
APLRGFVRERVQQLKNGVNVGSSLLFYGCRNEDEDYLYRDEWPQYAKELGESFELITAFS
RANPNKKVYVQDKILEQAKKINQLLQDGAIIYVCGDASHMARDVQSSFAKVLSQERDIEL
EKAAELIRSLKVQNRYQEDVW
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggcattggatagattggacttgacagttgtcattgtattggcagttgcagttactgta
tactttttaaagagtcaattttttaccaagcccgaatctagtgggtttttacacacagac
actgctggaggcaattctcgtgatattttggcaacattgtcgaaaaacaacaaaaacacg
ttactcttgtttgggtctcaaacaggtactgctgaagattattgtaacaagatgtctcgt
gaattgagtgctaggtttggtttaaagactatggttgctgattttgctgattatgattgg
gacaattttggtgatattaaagatgaaactttggtgtttttcattatggcaacttatggt
gaaggtgaaccgactgacaatgccattgaatttattgactttttggataatgaggcagat
acgttgagtgctttgagatatactgtttttggattgggtaattccacttatgaatttttc
aatgctattggtagaaaaatcgatcaaaaattggaagaaaaaggggccgaaagatttgct
gagtatggagaaggtgatgatggccaaggaactatggatgaagatttccttgcttggaag
gacggtgtttttgattctttaagaaataatttggatcttgaagaaaaagaattgaagtat
gaaccaagtttaaaattggaagttagggatgatttaactattgatgatccttcagtatct
ttgggtgaaccagataagtcatatgttaacactaaagctggtactgatttatcgaaaggt
ccatttgatcattctcatccttatttggctcctataaccaaggtgaaagagttgtttttt
accaaggaaagatcttgtgttcacgttgagtttgatctttctaattctaatttgaaatat
actactggtgatcatttagcaatttggccgtccaatgccaacgaatatgttgagcttttc
ttgaaagcgtttgatttaactgaacaacgtgatactgtttttgatttgaaagcacttgat
tctacttatcagatcccattccctactccaatcacatatgaggcagttattagacatcat
ttggaaattagtggtcctgtttcaagacaatttttcctttcaatcgcagcatttgcacca
gatgaagaaacaaagactagattaaccactgttgccaatgataaacaaaaatatgcagaa
gagattactcacaagaaattcaatattgctgatggattattgcatctttccaatggtaaa
ccatggaccaaggtcccatttgaattcttgattgaaaatgtccaacatttcactcctcgt
tattattcgatttcgtcttcgtcattgagcgaaaagacccatattgatattaccgcagtt
gttgaatctgaagctgaatcagatggaagagttgttactggtgttgttactaacttattg
aaaaatattgaaattaacaagaattcatcttcagataaaccaattgttagttatgatttg
aaaggtccacgaaataaatttcaaaattataaattaccaatacatgttagaagatcaaca
tttaaattacctagcagttctaaaacaccaataattttagttggaccaggaacaggtgtt
gcgccattacgaggatttgttagagaaagagttcaacaattgaagaatggagttaatgtt
ggctcatcattgttattttatggatgtagaaatgaagatgaagattatttatatcgtgac
gaatggccacaatatgctaaagaattgggtgaatcatttgaattgattactgcattttca
agagccaatcctaataaaaaagtttatgttcaagataagatattggaacaagcgaaaaag
attaatcaattgttacaagatggggctataatttatgtttgtggagatgctagtcatatg
gcaagagatgtacaactgtcatttgctaaagtattgagtcaagaaagagatattgaattg
gaaaaggctgcagaattgattagaagcttgaaggtgcaaaatagatatcaagaagatgtc
tggtaa

DBGET integrated database retrieval system