KEGG   Candida orthopsilosis: CORT_0F00920Help
Entry
CORT_0F00920      CDS       T02488                                 

Definition
Car1 arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cot  Candida orthopsilosis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CORT_0F00920
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CORT_0F00920
Enzymes [BR:cot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CORT_0F00920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:153029..153979
Genome map
AA seq 316 aa AA seqDB search
MSIEYKFHPDKKATIITAPFSGGQPKGGVELGPEYILNAGFQKQIDSLGWATRIENPLGD
VSLEEKKSNVKDEYGVKNAAIVSKCCQLIFEASKKSLSEGRLPLVIGGDHSIGTATVGAS
LAHNPNTCVVWVDAHADINSPKTTDSGNLHGCPLSFLMGIDEESYPPEYSWVPRILKSNK
LVYIGLRDVDEGEKKILRDHNIAAFSMYHIDKYGIGKVVEMALDKVNPNRNCPVHLSYDV
DAIDPSFVPATGTRVEGGLSLREGLFVAEEIAQSGLLQSLDIVETNPMLAETEEHVLDTV
SAACAIGRCALGQTLL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgaatacaaatttcatcctgataaaaaagctacaataataacagcaccattt
tcaggcggtcaaccaaaaggtggtgttgaattaggtccggaatacatcttgaatgctggt
ttccaaaaacaaattgattcccttggatgggccaccagaatagagaatccattgggagat
gtatcacttgaagaaaagaaatctaatgtcaaagatgaatatggagtcaaaaatgctgct
attgttagtaaatgttgtcaattaatatttgaagctagtaaaaagagtttgagtgaaggg
aggttacctttggtaattggtggtgatcattcaattggaactgcaactgtcggtgccagt
ctagctcataatccaaatacttgcgttgtatgggttgatgcacatgctgatattaatagt
ccaaagactaccgattcaggtaatttgcatgggtgtccgttaagtttcttaatgggaatt
gatgaagaatcatatccccccgaatatagctgggttccacgtatattaaagtcaaataaa
ttggtatacattggattaagagacgtcgatgaaggtgaaaagaaaattttacgtgatcac
aacattgccgctttttcaatgtatcacattgacaaatatggtattggaaaagttgttgaa
atggcattggataaagtcaatccaaatcgtaattgtcccgtccacttatcatatgatgtc
gatgccattgatccttcatttgtaccagctactggtaccagagttgaaggtggattaagt
ttaagagaagggttatttgttgctgaagaaattgctcaactgggattattacaaagttta
gatattgttgaaaccaatccaatgttggctgagactgaggaacacgttttggatactgta
agtgctgcttgtgctattggtagatgtgctttaggacaaactttgctatag

DBGET integrated database retrieval system