KEGG   Candida orthopsilosis: CORT_0F00950Help
Entry
CORT_0F00950      CDS       T02488                                 

Definition
Mpd1 protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cot  Candida orthopsilosis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cot00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CORT_0F00950
Enzymes [BR:cot01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CORT_0F00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(159236..160138)
Genome map
AA seq 300 aa AA seqDB search
MYLSYLLSLFQILLLVTARAQADEYTNDPNIFELTASNFDKVIHGSNYTSIVKFYAPWCG
YCQQLKPIWRKLGKAVGKDSKLSVNVAAVNCDKDYNKPLCAQYQISGFPTVMVFRPPKYD
KAKVLNGKKSRHASEAYNGQRTVKAMSQFLGSRLKNYVKKVHNLDSDLIKWISDDSDKTK
VLLITKSNSISPLLKSLAIDFLTKVDFAMYGKYNDQPKSIEIDGKSVDIPKKDSSSLLYF
DKEKGKFIAYDATEKLDDKTQISKWIRTVAQIDPVEGPLSKRGKKLLKYKGKKKVEHDEL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtacctttcatacctactatcgttatttcaaatacttctccttgttactgcaagagca
caagcagatgagtatacaaatgatccaaacattttcgagttgactgcgtctaactttgat
aaagttatccacggctcaaattatacctcaatagttaaattttatgcaccttggtgtggt
tattgtcaacaattgaaaccaatatggagaaagttgggtaaggctgtgggtaaagactcc
aagctcagtgtcaatgtagctgcagtcaactgtgacaaagattacaacaaaccactttgt
gcccaatatcaaatcagtggattcccaaccgttatggtttttaggccacctaaatatgac
aaggctaaagtattgaatggtaagaagctgaggcatgcaagtgaagcatataatggtcag
cggacagtgaaggcgatgctgcagttcttgggatccaggttgaagaactatgttaaaaag
gtgcacaatttagacagtgatttaatcaaatggattagcgatgattccgacaaaactaag
gtccttctcattacaaagtccaatctgattagtccgttgttgaaatcattggcaatcgat
tttcttaccaaagtggattttgcaatgtatggaaaatataatgatcaaccaaagagtatc
gaaatcgacggtaagctggtggatattccaaaaaaggactcgtcttctttgctctacttt
gataaagaaaagggcaagttcatcgcctacgatgcaacagaaaaattggatgataaaacc
caaatatcaaaatggattagaactgttgctcaaatcgacccagtggaaggaccattatct
aaaagaggtaaaaaattattaaaatacaagggcaagaagaaagtcgaacacgatgaattg
taa

DBGET integrated database retrieval system