KEGG   Candida orthopsilosis: CORT_0F00970Help
Entry
CORT_0F00970      CDS       T02488                                 

Definition
Yuh2 ubiquitin C-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CORT_0F00970
Peptidases [BR:cot01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CORT_0F00970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:join(160775..160813,160864..161766)
Genome map
AA seq 313 aa AA seqDB search
MSDSGWNTIDSDAGVFTELVEKLGVTNVEINDLYSIDSETLRVLQPIYGVIFLFKYGKKD
REHASLNKPITGEYDANYQDMGLFFANQMIQNACATQAVLNVLFNVDDVNLGEELNNFKS
FVTGFDSEMIGETLSNSELIRSIHNSFSTPSLVAQEDKPPPQDYDDKTDGLFHFVGYVMK
NSQIYELDGLKQYPIKHGECQSQDEFIEKLPGVLQDRISAYDASELRFSLLAITNNKLEQ
ARATGDEVEIASQLDKRELWQRENELRKHDYTGLIVQLLKNISKEKSDQEWEALLQKGRN
KTQQTIAQSIKKS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacagtggttggaacactatagattccgatgcaggtgtgttcacagaacttgtt
gaaaaattaggcgtgacaaatgtcgagattaatgatttatactccattgattcagagacg
ttacgagtattgcaacccatctacggtgtaatctttttgttcaagtacggtaagaaggat
agagagcatgctagtttgaacaaacccataactggtgagtacgatgccaattatcaagat
atgggactattttttgccaaccaaatgattcaaaatgcttgtgctacacaagcagtgctc
aatgtgttgttcaacgttgatgatgtaaacttgggtgaagaattgaacaactttaaactg
tttgtcactgggtttgactcagagatgatcggggagaccttgtccaacagtgaactaatt
cgatctatacataattcgttcctgactccatcattagttgctcaagaggacaaaccacca
ccacaagattatgatgacaaaaccgacgggttatttcattttgttggatatgtgatgaaa
aatagtcagatatatgaattagatggattgaagcagtatccgattaaacatggtgaatgt
caaagtcaagacgaatttattgaaaaattaccaggagtattacaagacagaatcagtgca
tacgatgccagtgaactaaggttctcacttttagcaataacaaacaacaagttggagcaa
gcacgggctaccggtgatgaagtggagattgcaagtcaattggataaacgagaactttgg
caacgagaaaatgaattgaggaagcatgattacactggattgattgtacagttgttgaag
aatataagtaaagaaaagtcggatcaagagtgggaagctttactacaaaaaggcagaaac
aagacccaacaaacgattgctcaatcaataaagaaaagttag

DBGET integrated database retrieval system