KEGG   Candida orthopsilosis: CORT_0F01220Help
Entry
CORT_0F01220      CDS       T02488                                 

Definition
Fol2 protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cot  Candida orthopsilosis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CORT_0F01220
Enzymes [BR:cot01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CORT_0F01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:220617..221435
Genome map
AA seq 272 aa AA seqDB search
MSEHKDNENHNLKREHESVNGTHSPRPVVQPKRSKLITSSHFDLNSPLQTRPASPLILNP
PIDSDGLSWPSHGARSRIDQTPEEAAEREKRIADAVRTILTELGEDTNREGILETPERYA
RAMLFFTKGYEDNIRDVIKHAVFEENHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPN
KRVLGLSKLARLAEMYARRFQVQERLTKQIAMALSEILKPRGVAVVMEATHMCMVSRGVQ
KTGSSTTTSCMLGCFRDHQKTREEFLTLLGRK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcataaggacaatgagaatcacaatctcaagagggaacatgaatctgttaac
ggtacccactctcctagacctgttgtccaaccaaagagatctaaactcattacatcatca
catttcgatcttaactcaccactacaaactagaccagcatcacctttgatccttaaccca
ccaatagactcagatggtttatcatggccatcacatggcgccaggtcgcgtatcgatcaa
actccagaagaagcagctgaacgggaaaagcgtattgctgatgctgtgcgtacaatcttg
acggaattaggtgaggatacaaatcgtgaagggattttagaaacgcctgaaagatatgct
cgtgccatgttgtttttcactaaaggttacgaggataatattcgtgatgtgattaaacat
gcagtttttgaggaaaaccatgatgaaatggtgattgttagagatattgaaatatactct
ctttgtgaacatcatttggttccattttttggtaaagtacatattggttatattcccaac
aagcgggtcttggggttgagtaaattggcgagattagctgaaatgtatgcaagaagattt
caggttcaagaaagattgactaaacagattgccatggcgttgagtgagattttgaaacct
cgaggtgtagctgtagttatggaagctacacatatgtgtatggtgagtcgtggtgtacaa
aagactggcagttcaactactacaagttgtatgcttggatgttttagagatcaccaaaag
accagagaagaatttttgaccttattaggaagaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system