KEGG   Candida orthopsilosis: CORT_0F01220Help
Entry
CORT_0F01220      CDS       T02488                                 

Definition
Fol2 protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cot  Candida orthopsilosis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cot00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:220617..221435
Genome map
AA seq 272 aa AA seqDB search
MSEHKDNENHNLKREHESVNGTHSPRPVVQPKRSKLITSSHFDLNSPLQTRPASPLILNP
PIDSDGLSWPSHGARSRIDQTPEEAAEREKRIADAVRTILTELGEDTNREGILETPERYA
RAMLFFTKGYEDNIRDVIKHAVFEENHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPN
KRVLGLSKLARLAEMYARRFQVQERLTKQIAMALSEILKPRGVAVVMEATHMCMVSRGVQ
KTGSSTTTSCMLGCFRDHQKTREEFLTLLGRK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcataaggacaatgagaatcacaatctcaagagggaacatgaatctgttaac
ggtacccactctcctagacctgttgtccaaccaaagagatctaaactcattacatcatca
catttcgatcttaactcaccactacaaactagaccagcatcacctttgatccttaaccca
ccaatagactcagatggtttatcatggccatcacatggcgccaggtcgcgtatcgatcaa
actccagaagaagcagctgaacgggaaaagcgtattgctgatgctgtgcgtacaatcttg
acggaattaggtgaggatacaaatcgtgaagggattttagaaacgcctgaaagatatgct
cgtgccatgttgtttttcactaaaggttacgaggataatattcgtgatgtgattaaacat
gcagtttttgaggaaaaccatgatgaaatggtgattgttagagatattgaaatatactct
ctttgtgaacatcatttggttccattttttggtaaagtacatattggttatattcccaac
aagcgggtcttggggttgagtaaattggcgagattagctgaaatgtatgcaagaagattt
caggttcaagaaagattgactaaacagattgccatggcgttgagtgagattttgaaacct
cgaggtgtagctgtagttatggaagctacacatatgtgtatggtgagtcgtggtgtacaa
aagactggcagttcaactactacaagttgtatgcttggatgttttagagatcaccaaaag
accagagaagaatttttgaccttattaggaagaaagtaa

DBGET integrated database retrieval system