KEGG   Candida orthopsilosis: CORT_0F02790Help
Entry
CORT_0F02790      CDS       T02488                                 

Definition
Mcr1 NADH-cytochrome-b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cot  Candida orthopsilosis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CORT_0F02790
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CORT_0F02790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:572851..573747
Genome map
AA seq 298 aa AA seqDB search
MSTAMTRFLAPRYIVPFIGATASLGLAYHYSTQSFIRNETGKTFTGGDEWIDLTLKKAEQ
LNHNTKHLVFDLKDKDDVSGLVVASMLMTKFVTPKGNNVIRPYTPVSDVDQKGDIEFVIK
KYDEGKMSSHIHDLKEGDTLSFKGPFVKWKWEPNQFKSIALIGGGSGITPLYQLLHAITS
NPEDKTKVQLFYGNLSPDDILIKDRLDEIAKNNKDQVNITYFVNDKKGKDFDGVEGFITK
DFLQKNLDKPSPDTKIFVCGPPGLYDAISGNKKSPSDQGEVTGALADLGYTKEHVFKF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgctatgacaagatttctcgctcccagatacattgtgccattcattggtgcc
accgcttcccttggccttgcttaccactactccacacaatcatttattagaaatgaaact
ggaaagacttttactggtggtgacgaatggattgatttgaccttgaaaaaggccgagcaa
ttgaatcacaataccaagcacttggtttttgatttgaaagataaagacgatgtttctggt
ttggttgttgcttccatgttgatgaccaagtttgtcactccaaaaggtaataacgtcatt
agaccatacactcctgtgtcagacgtcgaccaaaaaggtgatattgaatttgttattaag
aaatatgacgaaggtaaaatgtcgagccacattcacgacttaaaagaaggtgacactttg
tctttcaaaggaccatttgttaaatggaagtgggaaccaaaccaattcaaatcgattgct
ttgattggtggtggttctggtattaccccattgtatcaattgttgcatgcaattacctca
aatccagaagacaagactaaagtccaattgttttacggtaatctttcccctgatgatatt
ttaatcaaggacagactcgatgaaattgccaagaacaacaaagatcaagtcaatattacc
tactttgttaacgacaagaaaggtaaagactttgatggtgtagagggcttcattaccaag
gactttttgcaaaagaacttggacaaaccaagcccggacacaaagattttcgtttgtggg
cctccaggtttatatgatgccatctcaggtaacaagaagtctccatctgatcaaggtgaa
gtaactggagctttggctgatttgggttacaccaaggagcacgtttttaaattttaa

DBGET integrated database retrieval system