KEGG   Candida orthopsilosis: CORT_0G00190Help
Entry
CORT_0G00190      CDS       T02488                                 

Definition
Hxk1 N-acetylglucosamine (GlcNAc) kinase
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
cot  Candida orthopsilosis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CORT_0G00190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CORT_0G00190
   00051 Fructose and mannose metabolism
    CORT_0G00190
   00052 Galactose metabolism
    CORT_0G00190
   00500 Starch and sucrose metabolism
    CORT_0G00190
   00520 Amino sugar and nucleotide sugar metabolism
    CORT_0G00190
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    CORT_0G00190
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CORT_0G00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:24364..26034
Genome map
AA seq 556 aa AA seqDB search
MIQSINTLINNLPSYGVKSGVANKNEAACSITSLESKEIEVDTKSIHSLSEGSSSLSSPR
SSPISSTDSISIHDFKISSSLDLIIKSFRDPLTDNNLEKHSELLLSDFNSSLTENSITML
PNYNISPAGDENGSYLVVDLGGSTLRVAVVDIAPQDEKYDSRSDRINVVVEEKWLISNEY
KVINRNFFKFIGSKIMETIKKQEILKSSDIIKTGITWSFPLDTTSYNNGKIRHVSKGYTI
GDDIYDKDLKQLFESVFQEEFNVKVDIRSILNDSLAVYAAGAFLDEKMRLAMVLGTGFNM
CCSLEASKDNMHPSKLIDKKMLFNTELSLFGQHLCDDFATKYDAIIDDRFDNFKHHFKTY
SSPDPETNTIFQPHELMTSGRYLPELTRLVLAELIERKEIFTEFDSEELNIISNVKYDGF
EGELMCFINESHDFDAIGERICQVYQWKKTISDSDISIIRYVIKAIIQRAAFIVANAIIA
FFKLIKQYNRLDDLKGLLTIGYVGSVLNHFHNYRNLVINYVNSSEDAKACGYKIDLELIE
NSSIIGAAIGAAYYSK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaagcataaacacacttatcaataatctcccatcgtatggggtaaagtctgga
gtcgctaacaagaatgaggcagcgtgctcaatcactagtttggaatctaaagagatagaa
gtggacaccaagtctattcattccttgtcagaaggttcttcttctttatcatcaccacgt
tcgtctcccatatcaagcacagattcgattagtattcacgatttcaaaatatcatcatcg
ctcgatttgattataaaatcgtttagggacccattgacagataacaacttggaaaaacac
tcagagcttcttttatccgactttaactcatcattgacggaaaattctataacaatgttg
ccaaattataatatctcaccagctggggatgaaaatggactgtatttggttgtcgatcta
ggtggatctacacttcgagttgcagtagttgacattgcaccgcaagacgaaaaatatgac
tctagatctgatcgaataaatgttgttgttgaggaaaaatggctaatatcaaacgaatac
aaggttattaaccgcaactttttcaaattcattggatcaaagattatggagactataaaa
aagcaagaaatattgaagctgtctgatattataaaaactggtatcacttggtcatttcct
ttggacacgacaagttacaataatggtaaaattcgccatgtgtcaaaaggatacacaatt
ggagacgatatttacgacaaagatttgaaacagttgtttgaatctgtttttcaagaggag
ttcaacgtaaaagttgatatcagatcaatcttgaacgactcattagctgtgtacgcagca
ggagcatttttggatgagaaaatgagattagctatggtgttggggaccggattcaatatg
tgctgctcattggaggcaagtaaagacaatatgcatccaagcaaattgattgacaaaaag
atgcttttcaacactgaattatcattgtttggacaacatttatgtgatgattttgctaca
aagtatgatgccattattgacgatcgatttgacaatttcaaacaccattttaaaacgtat
tcactgcctgaccccgagacaaacactatttttcaacctcatgagttgatgaccagtggt
aggtacttgcctgagttgactcgattagttttagctgaattgattgaaaggaaggagatt
ttcactgaattcgatagcgaggagctaaacataattctgaatgtcaaatacgatggtttt
gaaggtgagcttatgtgcttcattaatgaaagtcacgattttgatgccattggtgaaagg
atttgtcaagtataccagtggaaaaaaacaatttcagattcagacatttccataatcaga
tatgtaatcaaggcgattatacaaagagcagctttcatagttgcaaacgcaatcattgct
tttttcaaacttataaagcagtacaataggttagatgacttaaagggattgttaacaatt
ggttacgttggatcagtgttgaaccatttccacaactatagaaatttggttatcaattat
gtcaattcaagtgaagatgccaaggcttgtggttacaagattgatttggaattgattgaa
aacagctcaataattggagctgcgattggagcagcttactattcaaagtaa

DBGET integrated database retrieval system