KEGG   Candida orthopsilosis: CORT_0G00190Help
Entry
CORT_0G00190      CDS       T02488                                 

Definition
(RefSeq) Hxk1 N-acetylglucosamine (GlcNAc) kinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cot  Candida orthopsilosis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CORT_0G00190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CORT_0G00190
   00051 Fructose and mannose metabolism
    CORT_0G00190
   00052 Galactose metabolism
    CORT_0G00190
   00500 Starch and sucrose metabolism
    CORT_0G00190
   00520 Amino sugar and nucleotide sugar metabolism
    CORT_0G00190
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    CORT_0G00190
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CORT_0G00190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:24364..26034
Genome map
AA seq 556 aa AA seqDB search
MIQSINTLINNLPSYGVKSGVANKNEAACSITSLESKEIEVDTKSIHSLSEGSSSLSSPR
SSPISSTDSISIHDFKISSSLDLIIKSFRDPLTDNNLEKHSELLLSDFNSSLTENSITML
PNYNISPAGDENGSYLVVDLGGSTLRVAVVDIAPQDEKYDSRSDRINVVVEEKWLISNEY
KVINRNFFKFIGSKIMETIKKQEILKSSDIIKTGITWSFPLDTTSYNNGKIRHVSKGYTI
GDDIYDKDLKQLFESVFQEEFNVKVDIRSILNDSLAVYAAGAFLDEKMRLAMVLGTGFNM
CCSLEASKDNMHPSKLIDKKMLFNTELSLFGQHLCDDFATKYDAIIDDRFDNFKHHFKTY
SSPDPETNTIFQPHELMTSGRYLPELTRLVLAELIERKEIFTEFDSEELNIISNVKYDGF
EGELMCFINESHDFDAIGERICQVYQWKKTISDSDISIIRYVIKAIIQRAAFIVANAIIA
FFKLIKQYNRLDDLKGLLTIGYVGSVLNHFHNYRNLVINYVNSSEDAKACGYKIDLELIE
NSSIIGAAIGAAYYSK
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaagcataaacacacttatcaataatctcccatcgtatggggtaaagtctgga
gtcgctaacaagaatgaggcagcgtgctcaatcactagtttggaatctaaagagatagaa
gtggacaccaagtctattcattccttgtcagaaggttcttcttctttatcatcaccacgt
tcgtctcccatatcaagcacagattcgattagtattcacgatttcaaaatatcatcatcg
ctcgatttgattataaaatcgtttagggacccattgacagataacaacttggaaaaacac
tcagagcttcttttatccgactttaactcatcattgacggaaaattctataacaatgttg
ccaaattataatatctcaccagctggggatgaaaatggactgtatttggttgtcgatcta
ggtggatctacacttcgagttgcagtagttgacattgcaccgcaagacgaaaaatatgac
tctagatctgatcgaataaatgttgttgttgaggaaaaatggctaatatcaaacgaatac
aaggttattaaccgcaactttttcaaattcattggatcaaagattatggagactataaaa
aagcaagaaatattgaagctgtctgatattataaaaactggtatcacttggtcatttcct
ttggacacgacaagttacaataatggtaaaattcgccatgtgtcaaaaggatacacaatt
ggagacgatatttacgacaaagatttgaaacagttgtttgaatctgtttttcaagaggag
ttcaacgtaaaagttgatatcagatcaatcttgaacgactcattagctgtgtacgcagca
ggagcatttttggatgagaaaatgagattagctatggtgttggggaccggattcaatatg
tgctgctcattggaggcaagtaaagacaatatgcatccaagcaaattgattgacaaaaag
atgcttttcaacactgaattatcattgtttggacaacatttatgtgatgattttgctaca
aagtatgatgccattattgacgatcgatttgacaatttcaaacaccattttaaaacgtat
tcactgcctgaccccgagacaaacactatttttcaacctcatgagttgatgaccagtggt
aggtacttgcctgagttgactcgattagttttagctgaattgattgaaaggaaggagatt
ttcactgaattcgatagcgaggagctaaacataattctgaatgtcaaatacgatggtttt
gaaggtgagcttatgtgcttcattaatgaaagtcacgattttgatgccattggtgaaagg
atttgtcaagtataccagtggaaaaaaacaatttcagattcagacatttccataatcaga
tatgtaatcaaggcgattatacaaagagcagctttcatagttgcaaacgcaatcattgct
tttttcaaacttataaagcagtacaataggttagatgacttaaagggattgttaacaatt
ggttacgttggatcagtgttgaaccatttccacaactatagaaatttggttatcaattat
gtcaattcaagtgaagatgccaaggcttgtggttacaagattgatttggaattgattgaa
aacagctcaataattggagctgcgattggagcagcttactattcaaagtaa

DBGET integrated database retrieval system