KEGG   Candida orthopsilosis: CORT_0G00400Help
Entry
CORT_0G00400      CDS       T02488                                 

Definition
Csk1 mitogen-activated protein (MAP) kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cot  Candida orthopsilosis
Brite
Enzymes [BR:cot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CORT_0G00400
Protein kinases [BR:cot01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CORT_0G00400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:join(56286..56567,56622..57461)
Genome map
AA seq 373 aa AA seqDB search
MASLRGKSGYFESCSTYTDKENYFLVDSRYEIIRVLGKGSYGVVCSAIDTKSLSTGLEHK
IAIKKVTKIFTKDILLVRAIRELKFMKFFKGHKNIASLLDSDIVYVKPYDGLYCFQELAD
LDLARVLYSNVQLSEFHIQNFMYQVLCGLKYIHSADVIHRDLKPGNILVTTQGTLKICDF
GLARGINPKFFKNRTATITNYVATRWYRAPELILSTKNYSKAVDVWAMGCILGELFGRRP
LFPGKNSHEQIHELFKILGSPPPETIKKYNWKIEGISWVKYKSVNWRSIYPFAPIEAIDL
IDNLLQWDCKKRFTVDEILEQDFLKYVRNVPEEASSRSFFDFSFEENFCSIPRLKEVLEA
EVSEFTETCNIGD
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgttgagaggtaaaagcggatactttgagtcatgttcaacatatactgataaa
gaaaattacttcctcgttgattcccggtatgagattattagagttttaggtaaagggtcg
tatggagttgtttgttctgcaatagacaccaagagtttgagtacaggccttgagcataag
attgcaataaagaaggtgacgaaaatatttaccaaagatatacttttggttagagcaata
agggagctaaagtttatgaagttcttcaaggggcataaaaatatcgcatcattgctcgat
tccgacattgtctatgtgaaaccatatgatggtctttattgtttccaggagttggcagac
cttgatttggcgagagtgttgtattcgaatgtccaattatcggagtttcatattcaaaat
tttatgtatcaggtgttgtgtggcctcaagtatatacactcagccgatgttatacacaga
gacttaaaaccggggaatattttagtaacgactcaagggacacttaagatttgcgacttt
ggtttagcacgaggaataaaccccaaatttttcaaaaaccgtactgccacaatcaccaac
tatgttgccacaagatggtatcgtgcacctgaattgatattatcaacaaagaattactca
aaagcggttgatgtttgggccatgggctgcatacttggggaactatttggaagaagacca
ctttttccaggaaagaatctgcatgaacagattcatgaattattcaagattttgggcagc
ccaccgccagagacgataaaaaagtacaattggaagattgaggggattctgtgggtaaag
tacaaatcagtcaattggagatccatatacccatttgccccgattgaagcaatcgatttg
atagacaacctattacaatgggattgcaaaaaaagatttactgttgatgaaatacttgag
caggactttctcaagtatgtcagaaatgttcccgaagaagcaagcagcagatcgtttttt
gatttcagttttgaggaaaacttttgtagcatacctcggttgaaggaagtgttggaggca
gaggtgagtgaatttactgagacctgcaatattggagactga

DBGET integrated database retrieval system