KEGG   Candida orthopsilosis: CORT_0G01380Help
Entry
CORT_0G01380      CDS       T02488                                 

Definition
Pmt5 protein mannosyltransferase (PMT)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cot  Candida orthopsilosis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cot00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(270024..272183)
Genome map
AA seq 719 aa AA seqDB search
MSSKKEEVYRSGPYRPYIIESKRRKANNLTKKDVAVVLCLTSVSLLRIYKIYQPANIVFD
EIHILRYVQHYFKGTFFLDVHPPLGRFIYYLLAKLTHFDPDIDFEAIGEPYYNMSYTIMR
IFSGICGILAVDVTYLIMRLDSDQWVSLFTAAIVLFENSLATQSRFIFLDSALILGQALS
IYYLKLSCKTEPEGGSWWWYLVATGLSLGWTISMKLSGFYTLLWVGVFSLFDMYQLLGDL
TISTFKWFRLVFYKLLVLLVLPLTIYLSLWKIHFDLLPFEGPNSGLLSPRLRSTFQDYST
SPVEVLYGSTVTIKHNNLEKYLHSHDKTYPKGSQLQQVTLYSHEDPNNEWVVELPRKFYE
HKHYNQIRPVKDGEFIRLYHKATERYLHVSDVRPPISEHDYSKEVNCNETRGLLGNTEYE
FKLRILNKKPHATNNLPMIKLRATETVFMLVSRDNRCNLISHQDKLPSWGDYQNEVLCVS
ESTIPNSLWYIESNQHPLLDGKKPHVEFGSVPFLTKVWDLHQAMFRVNADFTTPHKYSSR
PESWPFVLKGVAYFQSLPQYTSLTEHTSQIYFLGNVTTYILSFIVVIIAMVKLAFYTLRN
FNPYVTYLDSEAKRKFYANALQHVAGWALHYLPYFFIYRNLYAHHYLPALYFAIMNLGEY
LNYQNRYIQISVMIGILSSSIYCFIEFIPLIYGTEWGVASCVAHKWFPGWHMDCMTYGG
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaagaaggaggaagtatacaggtcaggaccatatagaccatacattattgag
tcgaaaaggcggaaagctaataacctcaccaaaaaggatgttgcagtagtcctttgtctt
acatccgtttccctcctacgtatctacaaaatctaccaaccagcgaacattgtattcgat
gagatccatatcttacgatatgttcaacactacttcaagggcacattctttcttgatgtg
catcctccattgggtaggtttatttactatttgttggcgaaattgacccattttgaccct
gacattgattttgaagccattggagaaccatactacaacatgtcttacacaattatgaga
atattctcagggatttgcggcattctagccgtcgatgttacctatttgatcatgcgtctt
gattcagatcaatgggtttcattatttactgcagcgatagtattgtttgaaaattcattg
gccacacagtcgagatttatctttctagactccgccttgattttgggccaagctttgagt
atttactaccttaagttatcatgcaaaacagaaccagaaggaggatcgtggtggtggtac
ctagttgcaacagggttgtcactaggatggacaatttcgatgaaattgtctgggttttac
actcttttatgggtaggagtcttttccttgtttgatatgtaccagttgcttggtgactta
actatttccaccttcaaatggttcagacttgtattctacaaacttctcgtcttgttggtt
ctaccattaacaatctacctatcattatggaaaatacattttgatttacttcctttcgaa
ggtccaaatagtggcttactctcacctagacttagatccacttttcaagattacagcaca
tctcctgtcgaggtcctatatggaagtacggtcaccatcaagcacaataacctcgagaaa
tatcttcattcacatgataaaacttaccctaagggatcgcaattgcaacaagtgacccta
tacagtcatgaggatcctaacaatgagtgggtggtagaattgccacgtaagttttatgaa
cacaagcattataatcaaattcgaccagtcaaggatggagaattcatcagattataccac
aaagcgactgaaagatatctccatgtcagcgacgtgagacctcccatttctgagcatgat
tactcgaaagaagtaaattgtaatgaaacaaggggattgttgggcaatacagagtacgag
tttaaattgcgaattttaaataaaaagccacatgctacgaacaatttacccatgatcaag
ttacgtgctactgaaactgtattcatgttggtaagcagagataacagatgtaacttaatt
agtcatcaagataagcttccaagctggggtgattatcaaaatgaagttctatgcgttctg
gagtctacaattcccaactctttatggtacatagagtccaatcagcatccattattggat
ggcaagaaaccacatgtggaatttggactggtgccctttttgactaaagtttgggatctt
catcaagcaatgtttagagtgaacgcggactttactactccgcataaatatagttcacga
cctgaatcttggccatttgtactcaaaggtgttgcttacttccaaagcttgccacaatat
acaagcttgacagagcatacaagtcagatctactttttgggtaatgtaacaacctacata
cttagctttattgttgttattatcgccatggtcaagcttgcattctacaccttgcggaac
tttaacccctatgtgacttaccttgactcagaagcaaagaggaagttttatgccaacgcg
ttacagcatgttgcaggatgggcacttcattatttaccctactttttcatttatcggaac
ctttatgcgcaccattacttgccagcactatactttgctataatgaatttgggagagtat
ttgaattatcaaaacagatacattcaaattctggtaatgattggaatactttcgagttct
atttactgcttcattgagtttattccgctaatttatggaactgaatggggtgtagccagt
tgtgttgcccataaatggtttcctggttggcacatggattgtatgacttatgggggttga

DBGET integrated database retrieval system