KEGG   Candida orthopsilosis: CORT_0G01610Help
Entry
CORT_0G01610      CDS       T02488                                 

Definition
oxidoreductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cot  Candida orthopsilosis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cot00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:314437..315333
Genome map
AA seq 298 aa AA seqDB search
MADTDDKRKLLANPLHGIVIPIGLLLFGTWLFSWSYMPYTIAFIIIICSIQYYLATQRRS
SMHQTIWRDFELIDRTMVAPMTAIYRFKLGREDEILDIPTGHHLSCVFTIDGKDELRYYS
PISNQFDAGFFDILVKHYPHGKVTSKLASVQIGQTVKFRGPVGTLDYTPNETKTLGLIAG
GTGITPILQVITKVITNPEDKTELKVIFACQTPNQILLKSELDSIAEKYPKLSVYYTVDN
PSEEWTGGVGYVSKEMIKTMFDDKENTKILMSGPPAMKSHINGLLDELDWDKEKVFYF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcagacacagacgacaagagaaaattactagccaatccacttcatggaatagttatc
cctatcggcctacttctattcggaacttggttattcagttggtcctatatgccatacacc
attgcctttataatcatcatatgttcaattcaatattacttggccacacagcgtcgttca
tcgatgcatcaaacgatatggcgtgattttgaattgattgatcgaacaatggttgctcca
atgacggcgatttaccgattcaagttgggtcgtgaggatgaaatattggatattccaacg
ggacatcatttatcttgtgttttcacgattgatggtaaggatgaattacgatattattca
ccaatctcaaatcagttcgatgctggatttttcgatattttggtcaaacattatcctcat
gggaaagtgactagtaaattagcttcggtacaaatcggtcaaacggttaaatttagaggt
ccagtgggaacattggactatacgccaaatgaaacaaaaacattggggttgattgcgggt
ggaactggtataactccaattttgcaagttataactaaagtcataactaaccctgaagat
aaaactgaactcaaagtgatttttgcatgtcaaacccccaatcaaatcttgttgaagctg
gaattagattctattgcagagaagtatcccaaattgtcagtgtattatactgtggataat
cctagtgaagaatggactggtggtgttggatacgtgtcgaaggaaatgattaagactatg
tttgatgacaaggaaaacacaaagattttgatgtcgggcccaccagccatgaagagtcac
attaatggattacttgatgaattggattgggataaggaaaaagtattctacttttga

DBGET integrated database retrieval system