KEGG   Candida orthopsilosis: CORT_0G03510Help
Entry
CORT_0G03510      CDS       T02488                                 

Definition
Plc1 phosphoinositide-specific phospholipase C (PI-PLC), delta-form
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cot  Candida orthopsilosis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CORT_0G03510
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CORT_0G03510
Enzymes [BR:cot01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CORT_0G03510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:713833..716586
Genome map
AA seq 917 aa AA seqDB search
MSLASELQQVRSIDSGDEGSSSINTPSDSTPSLLRRISSPIISDLPSIFSHLRSNDSEPM
VKNSSGKSIMKRVLSGNKSSDSFGSSNSISSVTSPVLDKQSINDSRVAPNGEDVKPLEVD
SNITKSIDQLKIPSIFQTDGLPLLKVSHKSKKRILLFIDLVNFSFLWKLAPNIATSNNKR
LSMHGSSQRVHEFTVDDIKFVYTHEKGTNYREELRISKEFETRWITLIYFNQKKGNLKML
HLIADTEHDFKRLNSAITTMKGLRHHLATEFLVDLNELDEAHMKMILNREIPIQQKSPTK
EYLTFSDILKYARRLGISINKSYLESIFNNVFEAHSDSVDLKEKGLNFEQFKEFVSILKR
RDDILTLWECSCTDSSFGMNQLDFEYFYLRVQHEKYDSNEMDSIFCQFLTSDGHWTADDL
NSYLLSSYANPIQNIETDNYFTYPLTDYYISSSHNTYLTGRQVGGDSSIDGYVRALQRGC
RCIEIDIWDGPNEEDADSTDHEPIVNHGRTFTKPIRFANVVKTIQKFAFITSPYPLILSL
EINCSPLSQMKVVKILKDTLGASLVTSTIDDSSTLPSPETLKYKFLIKAKKTSPFKDLIE
TDEGSFTTSTTTTSYSEDNGVKPIGKTFSLRRKTKAPKVIDQVSELGVYLQGIKFRNFSL
PESKIYNHCFSLSEKTINKMMKDEVKKTSLDKHNRKYFVRVYPSGYRVTSSNFNPIKYWE
HGVQMVATNWQTYDLGQQLNEAMFEGVNKKGYVLKPAHLRKPIIKSSKFFKMFQPASKTI
RFSISIISAHQLSKPKDTDDIISPFVSCEIIGADKVNWDSPPMELGRTKVITDNGFNPIW
NETFSGTITGSLDLVFVKFVVNSVSNVDKMDDVHPLGLLVAKLSYLKQGYRYLYLNDLFG
EQLVYSSLFVKITYDCL
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgagcttagctagtgagttacaacaagtacgatccattgatagcggagatgagggttcc
agttctatcaacacaccttctgactccacaccaagcttactacgtaggatatcgtcacca
attatatccgacttgccgagtatatttagtcatttgaggtccaatgacagcgaacctatg
gtgaagaattccagtgggaaaagtataatgaaacgtgttttaagtggcaacaagtctagc
gatagttttggctcatcaaactcgatatcatcagttacaagtcctgtacttgataaacaa
tccatcaacgattcgcgagttgcaccaaatggcgaagatgtaaaaccactcgaggttgat
tcaaacataacaaaatcaatcgaccagttgaaaataccaagcatattccaaactgatgga
ctaccattattaaaggtgtcacacaaatcaaagaagagaatcctactattcatcgatttg
gtcaatttttcctttctctggaaactagctcctaatatagctaccctgaataataaaaga
ctatcaatgcacggatcaagtcagagagttcacgagttcaccgttgacgatataaaattt
gtgtacacgcatgagaaaggcaccaactatcgtgaggaactacgaatttcaaaggaattt
gaaacgaggtggatcactttgatttactttaatcagaaaaagggtaatttaaagatgctt
catttgattgctgatactgagcacgactttaaacggttgaatctggctattactacgatg
aagggtttacgacaccaccttgcaactgagtttctcgttgatttgaatgaattggatgag
gcgcatatgaagatgattttgaatcgggagattcctatccagcaaaaactgccaactaag
gaatatctcacattcagtgacattttaaaatatgctagacgtttaggtatcagcatcaat
aaactgtatttggagagcatatttaacaacgtattcgaagcgcatagcgattcggtagat
ctaaaagaaaaaggactcaattttgaacaatttaaggaattcgtatctatactaaagagg
agggatgatatcttaaccctttgggaatgcagctgcactgatagctccttcggaatgaat
caattggattttgaatacttctacttgagagtccagcatgaaaagtatgattcaaatgaa
atggattccattttttgtcaatttttgacaagtgatggtcattggactgccgacgaccta
aattcatacctattatcaagctatgcaaaccctatacaaaacattgagacagacaattat
tttacatatccattgacagattattacatatcatcatcacataacacgtacttgactggt
agacaagttggaggcgactcatcaatagacggctatgtcagagcactacagcgaggatgt
cgatgtattgagattgatatatgggatggtcccaatgaagaggatgccgactccactgat
catgagccaatagtcaatcatggaaggacatttaccaaaccaatcaggtttgcaaatgtg
gtaaagacaatccaaaagtttgcatttataacgtcgccatatccattgatcctcagtttg
gaaataaattgttctccattaagtcaaatgaaagtggtcaagattctaaaagatactttg
ggagctagtctcgtaacatccaccattgatgatagttccactttgccttccccggaaacg
ctcaagtacaagtttttgatcaaggcgaaaaaaaccagtccatttaaagatttaattgaa
accgacgaaggcagctttaccacatccaccactacaacttcatattcagaagataatgga
gtcaaaccaatagggaaaacttttagtttaagaaggaaaacgaaagctcctaaagtgatt
gatcaagttagtgaattgggtgtatacctacaaggtatcaagtttcgtaacttttcctta
ccggaatcaaaaatttacaatcattgtttttccctcagtgaaaagacaatcaacaaaatg
atgaaagacgaggttaagaaaacttcattggataagcataacagaaaatactttgtacgg
gtctatccatcaggatatagagtcacatcatccaacttcaacccaataaagtattgggaa
cacggggtgcagatggtggctacaaattggcaaacatatgaccttggccaacaactaaac
gaagcaatgtttgaaggggtcaataagaaaggttatgttctaaagccggcacatttgaga
aaaccgattattaagagctccaagtttttcaaaatgttccagccagcatccaagacaata
cggtttagtataagtatcatcagtgctcatcaattgctgaaaccaaaggatactgatgat
atcattagtccatttgtctcgtgtgagataattggtgctgacaaagtcaactgggactca
ccaccgatggaacttggaaggacgaaggttatcacagataatggattcaatcctatttgg
aatgaaacgtttagtggaacaattacgggatctctcgatttggtgtttgttaaatttgtg
gtgaactcggtttccaatgtagataaaatggacgacgtacaccctttggggctattagtt
gccaaattgagctacctaaaacaagggtataggtacctatatctcaacgatttatttggt
gaacaattggtgtactcttcattgtttgtcaagattacatatgactgtttatag

DBGET integrated database retrieval system