KEGG   Candida orthopsilosis: CORT_0G03710Help
Entry
CORT_0G03710      CDS       T02488                                 

Definition
catechol O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
cot  Candida orthopsilosis
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CORT_0G03710
Enzymes [BR:cot01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     CORT_0G03710
Exosome [BR:cot04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CORT_0G03710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:762695..763465
Genome map
AA seq 256 aa AA seqDB search
MSTSNTAEKTKEQKFHEYILNLPQDKVDAIKGKPLEVLKVIDDYGEHFMDIGRQKGELIT
TEIREKKPKVMIELGGYLGYSAVLFANELIQDPEAKYYSFEVNPEFAKIATDVIRLAGLS
KKIEIIVGKASYTLVDFKERLNKNGSFKALDFIFIDHWKDLYVPDLRELESLNFIAPGTV
ITADNILTPGAPEYAKYVRLSPEEKKEYNEKNPNPNGDEFLGRWNILYDTDTIKVEYPNG
HVDAVEITKCTDYLSG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtctacatccaatacagctgaaaaaaccaaggaacaaaaattccatgaatatatctta
aacttgcctcaagacaaagttgatgcaattaaaggaaaaccattggaggtcttgaaggta
attgacgactatggggaacattttatggacattggtcgtcagaagggtgaattgatcact
accgaaattagagaaaagaaacctaaagtgatgattgaattaggtggatacttgggatac
tctgcagtcttgtttgccaatgagttgatccaagatcccgaggccaagtattacagtttt
gaagtgaatccagaatttgctaaaattgctactgatgttatccgtttagctggattgtcc
aagaagatcgaaattattgtgggaaaagcatcctacacattggttgacttcaaagagaga
ctcaacaaaaatggcctgtttaaagcattggatttcatcttcattgatcattggaaggat
ttgtatgttcctgatttgagagagttagagtcgcttaactttattgcaccaggtaccgtg
attactgctgataacattttgacaccaggtgccccagagtacgcaaagtatgtcaggttg
tctcccgaggagaagaaggagtacaatgagaagaatcccaaccccaatggtgatgaattt
ttgggcaggtggaatatcttgtacgacactgatacaatcaaagtagagtaccccaatggc
cacgttgatgctgtcgagattaccaagtgtactgattacctctctgggtaa

DBGET integrated database retrieval system