KEGG   Candida orthopsilosis: CORT_0G04290Help
Entry
CORT_0G04290      CDS       T02488                                 

Definition
Pdi1 protein disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cot  Candida orthopsilosis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cot00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CORT_0G04290
Enzymes [BR:cot01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CORT_0G04290
Exosome [BR:cot04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CORT_0G04290
  Exosomal proteins of colorectal cancer cells
   CORT_0G04290
  Exosomal proteins of bladder cancer cells
   CORT_0G04290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:888852..890492
Genome map
AA seq 546 aa AA seqDB search
MQFWKYSTSALATLLAVVSITNASGPADGEAIADPNSAVVKLTTDNFATFLEENPLVLTE
FFAPWCGYCKMLGPEFSKAADTLNESHPNIKLAQVDCTEDQDLCAEHEIRGYPTLKIIRD
GESKSAEDYQGPREHQGIVDYMIKQSLPAVQVPTSWEDLEKLVKEQTKPYILKVNGAADD
IFEKIANAKRNDFTFIDVGKDHLKQLGKVINQDLKKASYLVVHPGEVVDAIKFDGKADLE
KLNEFISVETLPYFGEISRDTYMAYMSSSLPIAYYFYKTPEQRESITADLSKLGKKYRGK
LNIVGLDANLYGRHAEAISMDPEIVPLFAIQQVAENKKYGVNQAEHPEGPSFKVIEKFVA
DFFDNKLEPIVKSEPLPTEEERAANPVVKLVAHNYDEILKNTDKDVFVKYYAPWCGHCKK
LAPTWEELAEIFGSNKDDSQVVIADLDHTANDVDVPYEIKGYPTLLLYPANGEIDEKTGL
RTPIVFEGQRELNALLDFVKEKGALGVDGSSLQEKLKEAKEAAGDAAEEVKEKIAEEEEK
VEHDEL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcaattctggaaatactcaactagtgcattggctactcttcttgccgttgtgtcaatc
accaatgctagtggcccagctgatggcgaagccattgctgatccaaactccgccgttgtc
aaattgactaccgataactttgccacattccttgaagaaaatccattggttttaactgag
ttttttgccccatggtgtggatactgtaaaatgttgggaccagaattttccaaagctgct
gacactttgaatgaatcacatcctaatatcaagttggctcaagttgattgtactgaagat
caagacttgtgtgctgaacacgaaattagaggatacccaacattgaagattattagagat
ggtgaatcaaaatctgctgaagattaccaaggtccaagagaacatcaaggtatcgttgat
tacatgatcaaacaatcattgcctgctgtccaagttccaacctcatgggaagacttggaa
aaattggttaaggaacaaactaagccatacattttgaaagtcaatggcgctgctgatgat
attttcgaaaagatcgccaatgccaagagaaatgatttcacatttattgatgttggtaaa
gatcacttgaagcaattgggtaaagtaataaaccaagatttgaaaaaagcttcttacttg
gttgttcatccaggtgaagttgttgatgctatcaaatttgatggtaaagccgatttggag
aaattaaatgaatttatctcagttgaaactttgccatactttggtgaaatcagtagagat
acttatatggcttacatgtcgtcttctttgccaattgcttattacttttacaagacccca
gaacaaagagaatccattactgctgatttgagcaagttgggtaagaaatacaggggcaaa
ttaaacattgttggtttggatgccaacttgtatggaagacacgctgaagccatttcaatg
gatcctgaaattgttccattgttcgctattcaacaagttgctgaaaacaagaagtatggt
gttaaccaagccgaacacccagaaggtccttcattcaaggttattgagaaatttgtagcc
gatttttttgacaacaagttggaaccaattgttaaatcggaaccattacctactgaagaa
gaaagagcggctaatcctgttgttaagttagttgctcacaactatgatgagattttgaaa
aataccgataaggatgtctttgttaaatattatgcaccatggtgtggtcactgtaagaaa
ttggcaccaacttgggaagaattggctgaaattttcggatcaaacaaagacgattcacaa
gttgtaattgccgacttggatcacactgcaaatgatgttgatgttccatatgaaattaaa
ggatacccaaccttgttgttgtacccagccaatggtgaaatcgatgagaagactggtttg
agaaccccaattgtttttgaaggtcaaagagaattgaatgctttgcttgattttgtcaag
gaaaagggtgctttgggtgttgatggctcttcattgcaagaaaagttgaaagaagctaaa
gaagctgctggagatgctgctgaagaagttaaagaaaagattgcagaggaagaggaaaag
gttgagcatgatgaattgtaa

DBGET integrated database retrieval system