KEGG   Candida orthopsilosis: CORT_0H02280Help
Entry
CORT_0H02280      CDS       T02488                                 

Definition
Glc3 1,4-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cot  Candida orthopsilosis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cot00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CORT_0H02280
Enzymes [BR:cot01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CORT_0H02280
Exosome [BR:cot04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CORT_0H02280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(491357..493405)
Genome map
AA seq 682 aa AA seqDB search
MSDKGLIKGVLDLDPWLEPFSKELIDRQVTFRDWLSKLDSSEGSLLNFADSYRTYGLHAT
TRGYKIVEYIPDVEQVSLVGDFNNWNIESHQLKKVNNFGRWELDIEGDGVIPHDSRYKVA
MKLPSGEWIYRLDPWCQRATFNKDDNLYEGRFWNPPASEVYQFKNKRPVLSQGIKVYEAH
VGISTPEPKIGTYKNFTKNILPKIHELGYNTIQLMAIMEHAYYASFGYQITSFFAASSRY
GTPEDLKELIDTAHGYGIRVLLDVVHSHSSKNVADGLNMFNGTDHYLFHGGGRGNHDLWD
SRLFNYSSYETLRFLLSNLKFYLDVYQFDGFRFDGVTSMLYKHHGLSFGFSGDYNEYFNE
EWADNEAIAYLMLAHQLMKDISKKEHIEITSIAEDVSGMPTLCRPIDEGGIGFDYRLSMA
IPDMWIKILKHQKDEDWDLGNIVHTLINRRHGEKCISYCESHDQALVGDKTLAFWLMDKE
MYTNMSKLSELTPVIDRGLALHKLIRLVTFALGGEGYLTFEGNEFGHPEWLDFPRAGNGE
SYHYARRQFNLIDDDLLRYRYLFDFDAAMQHLDVLDSPQAYVSLKHEQDKVLVFERNGLL
FIFNFNPTQSFTDYKVGVETAGKYEIILNSDEAKFGGHDRIQDPVPGKKQEFFTNNDPWN
NRSNSLMVYIPSRTAIVLKKVD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaagggttaatcaagggggttcttgacttggacccatggttagaaccattt
tccaaggaattgatcgacaggcaagtaactttccgtgattggctttccaaacttgactcc
agtgaggggtcattactaaactttgctgattcttacaggacttatgggttacatgcaact
acccgtggatacaagattgtggaatatattcctgatgttgaacaagttagtttagtgggt
gatttcaataattggaatattgaatcacatcaattgaaaaaagttaataattttggtcga
tgggaattggatattgaaggtgatggagtcattcctcatgattcaaggtacaaggttgct
atgaagttacctagtggggaatggatttatcgattggatccttggtgtcaaagagccacg
ttcaataaggatgataacttatacgaagggagattttggaatccaccagcttcagaagtg
tatcagtttaagaacaaaagaccagtgttgtcacaaggtattaaagtatatgaagctcat
gttggtatttctacgcctgaacccaagattggtacatacaaaaactttaccaaaaacatt
ttgcccaagattcatgaattaggatacaatactattcaattaatggccattatggaacat
gcatattatgcatcatttgggtatcaaatcacaagtttctttgctgctagttcaagatat
ggaacaccagaagatttaaaagagttgattgatactgctcatggatacggaattagagtc
ttgttggatgtggttcattcacatagttcaaaaaatgttgctgatgggttgaatatgttt
aatggaactgaccattacttgtttcatggtggtggcagaggaaaccatgatttatgggat
tctcgtttattcaattattcaagctatgaaacattgaggttcttgttgtctaacttgaaa
ttttatcttgatgtgtatcaatttgacggatttagatttgatggggttacaagtatgttg
tataaacatcatggattgagctttgggttcagtggagactacaatgagtatttcaacgaa
gaatgggctgataatgaagctatcgcttatttaatgttggcacatcaattaatgaaagat
ataagcaaaaaagaacacattgagattacatccatcgctgaagatgtttcgggaatgcct
accttatgccgtccaattgatgaaggtggaattggatttgactatagattatctatggca
attccagacatgtggataaagatcttgaaacaccaaaaggatgaagattgggatcttggt
aacattgttcatactttgatcaatcgtcgtcatggcgaaaaatgtatcagttattgtgaa
tcccatgaccaagcattggttggagataagacattggctttctggttaatggataaagag
atgtataccaatatgtctaagcttagcgaattaacaccagtcattgatcgtggattggca
ctacacaagctcatcagattagtaacttttgccctcggtggagaaggctatttaactttt
gaaggaaatgaatttggtcatcctgaatggttggattttcctcgtgctggaaatggggaa
tcatatcattatgccagaagacaattcaatttaattgacgatgatttgttacgatacaga
tatctttttgattttgatgctgcaatgcaacatttggatgtattggattcacctcaagct
tatgtatcattgaaacatgaacaagataaagtattggtatttgaaagaaatggattattg
tttatattcaatttcaatccaacacaatcttttactgattataaagttggggttgagact
gctggaaagtatgagattatcttgaattcagatgaagcaaagtttggtggtcatgataga
attcaagatccagtgccaggtaagaagcaagaatttttcaccaataatgatccttggaat
aatcgctccaactcattaatggtttacattccaagcagaactgccattgttttgaagaag
gtagactaa

DBGET integrated database retrieval system