KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_0273Help
Entry
Cp162_0273        CDS       T02154                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cou00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
280135..281082
Genome map
AA seq 315 aa AA seqDB search
MRELVAETTLRPADLILPMFVADGIAEPREISSMPGVYQHTIPSLIEAVREAISVGIKCI
DLFGVPLDADKDAQGSQSWAPDGILNRGIRALRQEFGNDVIIMADTCLDEFTDHGHCGVL
DTDRFGEAVVDNDATIPLYQKMAVAQAEAGAHMVSPSGMMDGQILAIRDALDAHGFQDVA
IMAYSAKYASAFYGPFRDAVGSSLDGDRRTYQQDPANFRESLMEVDLDIEEGADFVMVKP
AMPYLDVLAEVASTSSVPVTAYQVSGEYAMLHAAARNNWLDLERVMMESLISIKRAGADQ
ILTYFAVDAAKKLQH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaattagtggcagagacgacgcttcgtcccgccgacctgattcttcctatgttt
gtcgcagacgggatagctgagccccgcgaaatttcttctatgcctggcgtataccagcac
actattccctccttaatcgaggccgttagagaagctatttccgtagggattaagtgcatt
gacctcttcggagtgcctctcgacgccgacaaggacgcacagggttctcaatcttgggca
ccagacggaatcctcaaccgtggcattagagcgttacgccaagagtttggcaatgatgtg
atcatcatggcagacacgtgtcttgatgagttcacagatcatgggcactgcggcgtactc
gacactgatcgcttcggcgaggcggttgtggataacgatgccactatcccgttgtatcaa
aagatggcggtggcgcaagcggaggcaggcgcgcacatggtaagcccctccggcatgatg
gatgggcagattttggcaatccgcgacgccctcgatgctcatgggttccaagacgtagcc
attatggcgtactccgctaagtatgcttcggccttctacggcccattccgtgacgcagtg
ggttcttctttggacggcgaccgtagaacatatcagcaggatccggctaattttagggaa
tcactgatggaagtcgacctagatattgaggagggtgcggactttgttatggtcaaacca
gccatgccttacctcgatgttctagcagaggtagcctcaacatcgtccgtgcctgtcacc
gcgtatcaggtatcaggcgaatatgccatgttgcatgcggctgcccgtaataactggctc
gatctggaacgtgtgatgatggaatcgttgatttctatcaaacgcgctggggcagaccag
attcttacttactttgccgtcgacgcggcgaaaaaactacagcactag

DBGET integrated database retrieval system