KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_0277Help
Entry
Cp162_0277        CDS       T02154                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cou00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
285542..286927
Genome map
AA seq 461 aa AA seqDB search
MRIAIIGAGLAGLTAAYEIHKLAPHADVEVFEATDRIGGKLFTVPFASGPTDMGAEAYLA
FREDTTEFFKELGLEESLRSPSGLPSLLYQGGSLHSMPSNTIMGIPGTSEDLGNLVSEET
RKRIDSEINAESIEWPQEISLGALLRERLGDDVVDHVVSALQGGVYSSTSDDLSVRATVP
QLARALDKLKEEGKPVTITGAVQRLLSEREERNKKRGYTPSVFASFAGGYAEMYEALAER
SEAKIHIDAFITAVDKKPEGFVLKGAEGVFDKVLLTVPAPTAALLLKNLVPEAAQQLKTI
KLASSAVVGMKFDNSAGLPYNSGILVATNAQDVRAKAFTFSSKKWPHLGERGGALVRASF
GRFGEDAIARADEDELVDAALDDLQTITGFDGRAAGLSEIFVQRWFGGLPVYGPGHLDTV
AAIKKALAQVEGIDATGAWADGVGVPAVIDAAKAAAKRALA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattgccatcatcggtgccggtttagcggggctaacggctgcttatgagattcat
aaactcgcccctcacgcggacgtagaggtgttcgaggcgacagatcgaattggcggcaaa
ctgttcacggttccgtttgcctccggtcctactgatatgggcgcagaagcatatttagct
tttcgggaagataccactgaatttttcaaagagctaggactcgaggagagtttgcgttct
ccctcggggttgccttctttgctataccagggaggcagccttcatagcatgccttccaac
acgatcatgggtatccccggcacaagtgaggacctaggtaacctggtcagcgaggaaact
cgcaaacgcattgactcggaaataaacgcggagtctattgagtggcctcaagaaataagc
ctgggtgcactcctgcgggaacgcttgggtgatgatgttgtagatcatgtggtgtcggcg
ctgcaaggcggcgtttattcttctacctcggatgatctcagcgtgcgcgctacggtaccg
cagctagcgcgggccttagacaagctcaaagaagagggaaagcccgtaaccatcacgggt
gctgttcaacggcttttgtctgagcgagaggaacgtaacaaaaaacggggatataccccg
agcgtttttgcgtctttcgcaggcggctatgcggagatgtatgaggctcttgctgagcgt
agcgaggcaaagatccacatcgatgcctttattaccgcagtggataaaaagcctgagggt
tttgtgctcaagggtgctgaaggcgtctttgataaagtcctgttgacggtgccggcgccc
acggcggctctgctgcttaagaaccttgttccggaggctgcacaacagcttaaaactatc
aagctagcgagctctgccgtggtaggaatgaagtttgataattccgcgggactcccctat
aactctgggattcttgttgccactaatgcccaagatgtgagggcaaaagcattcaccttt
tcctctaagaagtggcctcacctgggggaacgtggcggtgctttagtgcgggcctctttc
ggtaggtttggtgaggacgctatcgcgcgcgcagacgaagacgagcttgtcgacgcagcc
ctcgacgacctacagaccattacgggattcgacggacgtgctgctggattatcggagatc
tttgtccagcgatggttcggtgggttgccagtgtatggtcctgggcacttggacacggtt
gcagcaatcaagaaagcactggctcaggtcgagggcatcgatgctactggtgcgtgggcc
gatggcgtcggcgttcccgcagtgatcgatgctgcgaaagcagcggccaaacgagcactt
gcctaa

DBGET integrated database retrieval system