KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_0610Help
Entry
Cp162_0610        CDS       T02154                                 

Gene name
echA6
Definition
(RefSeq) Enoyl-CoA hydratase echA6
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Cp162_0610 (echA6)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cp162_0610 (echA6)
   00650 Butanoate metabolism
    Cp162_0610 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp162_0610 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cp162_0610 (echA6)
   00310 Lysine degradation
    Cp162_0610 (echA6)
   00360 Phenylalanine metabolism
    Cp162_0610 (echA6)
   00380 Tryptophan metabolism
    Cp162_0610 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cp162_0610 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cp162_0610 (echA6)
   00281 Geraniol degradation
    Cp162_0610 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cp162_0610 (echA6)
   00627 Aminobenzoate degradation
    Cp162_0610 (echA6)
   00930 Caprolactam degradation
    Cp162_0610 (echA6)
Enzymes [BR:cou01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cp162_0610 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
630832..631668
Genome map
AA seq 278 aa AA seqDB search
MFEQTRDDDASRALKEIETVKVSSDGFVRHIVLDRDDRRNALSGDMCRAIAHAVTEASAA
AVDNASVRAIMISGVGRAFCAGADLGSSVREGGEYSSDGAVYGAGFHDALFAMLHSIIQA
EVPIIANVQGAAVGAGMQLALACDLRVVGESAWFKVPAVSLGFALDGWTIGRAQKLCGGA
FARNLLLAGASLTPDAALASGFAAIQGDHAAAVAFAHEVAGLAPLSVRQLKSALNYGEAN
YSLDERSQSLFSQCWSSQDMKEARQARLEKRVPQFKGR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgagcaaactcgagacgatgatgcctcgcgggctttgaaagagatagaaactgtc
aaggtatcctccgatggttttgtgcgtcatatcgttttggatagagatgatcgccggaac
gctctttcgggtgatatgtgccgagctatcgcacacgccgtgactgaagcttctgctgcg
gccgtcgataatgcatcagtgcgtgcgatcatgattagcggagtaggacgagccttttgc
gcaggtgctgatctggggtcgtctgtgcgagaaggtggggaatattcctcggatggggcg
gtgtatggcgccggtttccatgatgcgctctttgctatgttgcattcgattattcaggca
gaggtgccgataatagctaatgtgcaaggggctgcggtaggcgctgggatgcagcttgct
ttggcgtgtgatctccgcgttgttggggagtctgcatggtttaaagtccccgctgtttct
ttgggctttgcactggatggatggactatagggcgtgctcaaaaactctgtggcggtgct
tttgctaggaatttgttgcttgccggtgcatcgttgaccccggatgcggctctggctagt
ggttttgccgcaattcagggggaccatgccgcagcagttgcttttgctcatgaagttgcc
ggattggcgcctctttctgtacggcagctcaagtcggcgcttaattatggggaggctaat
tactcgttggatgagcgctcacaatccttattttcccagtgctggtctagtcaggatatg
aaggaagcacgacaggcgagactggagaaacgagttccccaatttaaggggcgataa

DBGET integrated database retrieval system