KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_0679Help
Entry
Cp162_0679        CDS       T02154                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00900  Terpenoid backbone biosynthesis
cou01100  Metabolic pathways
cou01110  Biosynthesis of secondary metabolites
cou01130  Biosynthesis of antibiotics
Module
cou_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cp162_0679 (ispE)
Enzymes [BR:cou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Cp162_0679 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFM07037
Position
721855..722814
Genome map
AA seq 319 aa AA seqDB search
MIEENPELKHGKRITATAHSKVNLHLGVGPRRHDGYHELVTIFQSLSLKDEVECVELRGT
ATDQKSGIVAELDAYEADGVPTDNSNLAWKAADMVYAFHRSGGGPPLNKVRICLKKGIPT
AGGMAGGSADAAAALRLMQEYVTVKPTDKQLLTMASALGSDVPFTLLGGTRLGTGRGENL
VHVMSRGQYHWALAFSTQGLSTPAVFAKLDQMQRTPHLSVDDLTAALISGDPYHVAQYLH
NDMQPAALSLQPGLRKTLEVGKASGALAGIISGSGPTCAFLCPDAESAEDVAAELRLIGP
AATATGPALGATISTTTRS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgattgaggagaatccggagcttaagcacggcaaacgcatcacagcaaccgcgcattca
aaagtgaacctccaccttggagtgggcccgcggcgccacgacggctatcacgagcttgtc
actatttttcaatctttgagccttaaagatgaagtggaatgcgtagagctacgcggaact
gcaaccgatcaaaaatccggaatcgtagctgagcttgacgcctatgaggctgacggagtt
cctaccgataacagcaatcttgcgtggaaagccgccgatatggtctatgcttttcatcgt
tctgggggcggacctcccctgaacaaagtacggatctgcttaaaaaagggaattcctaca
gccggcggcatggcaggaggctcagcagacgctgctgcggcgcttcggcttatgcaggaa
tacgtcacagtaaaaccaactgataagcagctactcactatggccagcgccttaggatcg
gacgttcctttcacgcttttaggcggcacgcggctgggaaccgggcgtggagaaaacctc
gttcacgttatgtcccgaggccaatatcattgggcgttagctttttctacacaaggtctt
agcactcctgcggtctttgccaagctagatcagatgcaacgcaccccgcacttgtccgta
gatgatctgacagcagcgctgattagcggagacccgtaccacgtagctcagtatcttcac
aacgatatgcaacctgcagctctttcccttcagccaggtttgagaaaaactctggaggtg
ggtaaggcctcaggcgcgctggcagggattatttctggctctggccccacctgcgctttt
ctttgcccggatgcggaaagcgccgaggacgtagccgcagagctgcggcttataggacca
gctgcaaccgcaacaggtccagcgctaggcgctaccatttccaccacaaccagatcatag

DBGET integrated database retrieval system