KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_0778Help
Entry
Cp162_0778        CDS       T02154                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00300  Lysine biosynthesis
cou01100  Metabolic pathways
cou01120  Microbial metabolism in diverse environments
cou01230  Biosynthesis of amino acids
Module
cou_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cp162_0778 (dapE)
Enzymes [BR:cou01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Cp162_0778 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFM07133
Position
complement(1555215..1556288)
Genome map
AA seq 357 aa AA seqDB search
MLDLTADPIELTRALVDIESPSHHEEHIADLIEQALKSIPNVEVLRHGNTVVARTHRGLG
SRVILAGHIDTVPTADNVPSTLIDDVLFGCGTVDMKSGMAVYLHAFATLANSQELAQDLT
IVCYEGEEVSSEYNGLGHLQQAHPEWLQGDIALLGEPSGAVIEAGCQGSIRLRITAHGVR
AHSARSWLGTNAMHLLAPVISRIANYEAQEKLVDACLYHEGLNIVHCESGVATNTIPDEA
WMFVNFRFAPDRSLDDAMEHLLETLSLPSGVSYEVDDAVPGARPGLDRPAAVSLLRATGG
KFRAKYGWTDVSRFSEMGIPAVNFGPGDPSYCHKKDEQCPVHMITDVSNTLLDYLRT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttggacttgactgctgaccctattgaattaacccgtgcactggtggacattgaaagc
ccctctcaccacgaggagcatattgcggatctgatcgaacaggccttgaagtccattcct
aacgtagaggtactgcgtcatgggaataccgtggttgcacgcacccatcggggactagga
agcagagttatcctagccggacacatcgacaccgtacccacagcagataatgttccttcc
actctcatcgatgacgtactttttggctgtggaaccgtcgacatgaaatccggcatggct
gtatatctgcatgcttttgccacccttgctaattcccaagaattagcacaagaccttacg
atcgtttgctatgaaggcgaggaagtctccagcgaatacaacggattaggtcatctgcaa
caagcacaccctgaatggcttcaaggtgatatcgccttactaggagagccatcaggagca
gtcatcgaagcaggatgtcaaggatctattcgtctccggatcacggcgcacggtgtgcga
gcgcattctgcgcgttcgtggctaggaacgaacgccatgcatctcctagcgcctgttatc
tcccgtatcgcgaattatgaggctcaggaaaaacttgtcgacgcctgcctctaccacgag
ggactcaacatcgtgcactgtgaatctggtgtagccactaacacgattcccgatgaagcc
tggatgtttgtaaacttccgttttgccccggaccgcagcctggacgatgcgatggagcat
ttactggagaccctctcccttcctagcggggtgagctatgaggtggatgacgcggtgccg
ggagcgcggccgggactggaccgtccggctgctgtctctctcctacgcgcaacgggcgga
aaatttcgtgctaaatatggttggactgatgtgtctcgtttttctgaaatgggaattcct
gcagtgaattttggcccgggtgacccctcgtactgccataagaaagacgagcagtgcccg
gttcacatgatcacagacgtctccaacactttgttggactaccttcgtacctag

DBGET integrated database retrieval system