KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_0878Help
Entry
Cp162_0878        CDS       T02154                                 

Gene name
pfkA
Definition
6-phosphofructo kinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cou01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cou01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cou00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cou00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cou00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cou00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cou00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916632..917660
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYEDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKAGLEQIKENLADAEIDALIPIGGEGTLKGAQWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEHPFDINEICKAMERRFQMGEKYGIIVVAEGALPKEGTMSFAQGCVDQ
FGHQTFNGIGQVIGEEIKRRLGHDVRTTVLGHIQRGGTPTAYDRVLATRYGVHAARACHT
QDFGKMVALHGEHIDLIPLEEAVGTLKVVPAARYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactttaacctctggtggcgattgccccggactcaacgctgtcatccgc
ggtatcgtccgcacctgttccgaatacggttctaccgttgtgggatatgaggacggttgg
gttggtcttatggaagacaagcgcattcaactttacgatgatgaaaatattgatcgtatt
cttttgcgcggcggaacgatcttgggaactggccgccttcaccccgataagttcaaggca
ggacttgagcaaatcaaagagaatttagcagacgccgaaattgatgctttgattccgatt
ggtggcgagggcacgctaaagggagcccaatggctttctgataatgggatccctgtggtg
ggcgttcccaaaactatcgataatgatgtcaacggtaccgattacacctttggctttgac
accgcagtgtcggtagcaactgacgcaattgatcgtttacataccaccgcagaatcccac
aatcgcgtgatgatcgtggaagtgatggggcgtcatgtcgggtggatcgcattgcatgcg
gggatggcaggcggagcacactacactgtgattccagagcatccttttgatatcaatgag
atctgcaaagcgatggaacgccgtttccaaatgggggagaagtacggaattatcgtcgtt
gctgagggggctttgcctaaggaaggaacgatgagttttgcccaggggtgcgtagaccaa
tttgggcatcaaacctttaatggcatcggccaggtgatcggcgaagaaataaagaggcgc
ctaggtcatgacgtacgtactactgtgctcggacacatccaacgcggcggtactccgact
gcttatgatcgtgttttggcaacccggtatggtgttcacgctgcccgtgcttgccataca
caagactttggcaagatggtggcacttcatggtgagcatattgacctaattcctttggaa
gaagcagtaggaactttgaaggtagttcctgcggctagatatcggacagccagagctctc
tttggataa

DBGET integrated database retrieval system