KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1102Help
Entry
Cp162_1102        CDS       T02154                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00010  Glycolysis / Gluconeogenesis
cou00051  Fructose and mannose metabolism
cou00562  Inositol phosphate metabolism
cou01100  Metabolic pathways
cou01110  Biosynthesis of secondary metabolites
cou01120  Microbial metabolism in diverse environments
cou01130  Biosynthesis of antibiotics
cou01200  Carbon metabolism
cou01230  Biosynthesis of amino acids
Module
cou_M00002  Glycolysis, core module involving three-carbon compounds
cou_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp162_1102 (tpiA)
   00051 Fructose and mannose metabolism
    Cp162_1102 (tpiA)
   00562 Inositol phosphate metabolism
    Cp162_1102 (tpiA)
Enzymes [BR:cou01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cp162_1102 (tpiA)
Exosome [BR:cou04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cp162_1102 (tpiA)
  Exosomal proteins of bladder cancer cells
   Cp162_1102 (tpiA)
  Exosomal proteins of melanoma cells
   Cp162_1102 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFM07447
Position
1178989..1179768
Genome map
AA seq 259 aa AA seqDB search
MERKPLIAGNWKMNLDHMQAVATVQKLAFALPAEYYEKVDVAVTVPFTDLRSVQTVIDGD
KLQITYGAQDVSEHESGAYTGEISAAMLAKLGCTWVVVGHSERREYHGESSKLVAAKAKA
ALSKDISPIVCVGEPLTIREAGTHVDFVVEQTRESLAGLTEDELAKTVIAYEPVWAIGTG
KVASAADAQEVCKVIRGLIKELANEKIAAGIRILYGGSVKEETVAEIVGQPDVDGGLVGG
ASLDGEAFAKLAANAATGL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagccgctcatcgccggtaactggaagatgaatttagaccacatgcaagct
gtggcaacggttcagaagttagcgtttgcacttcctgccgaatactacgagaaagtggat
gtcgcagtcactgtaccgttcacagatctacggtctgtccagactgtgattgatggagat
aaacttcagatcacgtacggcgcccaagatgtatcagagcatgaatcgggcgcttacact
ggagaaatctctgcagctatgcttgcaaagcttggctgtacatgggttgtggtggggcac
tcggagcgtcgtgagtatcatggtgaatcttcgaaactcgttgcggcgaaggctaaagca
gcactgagcaaagatataagccctatcgtttgcgtcggtgagcctctaacgatccgggaa
gcaggaactcacgtagatttcgtcgtggagcaaacccgtgagtcgcttgcgggcctgacc
gaagacgagcttgctaagaccgttatcgcttatgagccggtttgggcaatcggtaccggg
aaggttgcttctgctgctgatgcccaagaggtgtgtaaagtaatccgcggtttgattaaa
gaacttgccaacgagaaaatcgccgcaggaattcgtatcctgtatggcggttctgtaaaa
gaagagacagtagcagagatagtcggacaacccgatgtagatggtgggcttgtcggcggt
gcttctcttgatggcgaggcatttgccaagcttgcagctaatgcagctaccggtctttaa

DBGET integrated database retrieval system