KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1290Help
Entry
Cp162_1290        CDS       T02154                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cp162_1290
Enzymes [BR:cou01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cp162_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1386993..1388075)
Genome map
AA seq 360 aa AA seqDB search
MGTCGRTLYPFSAVVGQERLRLALLLCAISPRIGGVVIRGEKGTAKTTTVRAFARLLGEA
PLVDLPIGATEDRVVGSLDMETVLTTGKARYNPGLLSQADGGVLYVDEVNLLADHLVDSL
LDAAATGQVTVERDGISYSSPANFVLVGTMNPEEGELRPQLLDRFGLAVDVMASKDTDVR
AEIMRRRLAFESAPQSFAQAWSHEDASTALQIQKAKQRVQQLQLSNVNLNRIAHLCAAFD
VDGMRADLVIARTALAHAAWRGASMVEDEDIRVAAELALPHRRRRDPFDEPGLDQEQLDQ
EMEKARDQHPDASDKAEEPQCEKEQHGLENKSSETQSEQPTSDGQEECATTGAPFRSTGA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggcacctgtggacgcacactatatcctttctctgcagtagtagggcaggagcgatta
agactggcattactcttatgcgcaatttctccgcgtattggtggtgtagttatccgcggg
gaaaagggaacagcgaagaccactacggtgcgagcttttgcgcgtttgctaggagaagcc
cctttagttgatctccctatcggtgccacagaggatcgagtcgtggggtccctggatatg
gagacagtcttgaccaccggaaaagctcgctataacccgggcttgcttagtcaagcagac
ggtggggtgttgtacgtcgatgaggtaaatctcctcgcagatcacctcgtcgattcgctc
ttagacgcggcggcaacggggcaagtaacagttgaacgggatggcatttcttattcttct
cctgccaactttgtgctcgtggggacaatgaacccagaagaaggcgagttgcggccgcaa
ttgcttgatcgtttcggattggctgttgacgttatggcgtccaaagacactgatgtacga
gcagaaataatgcggcgtcggcttgctttcgaatcagccccgcaatcttttgctcaagcg
tggtcccatgaggatgcatcgacggcgctgcaaatacagaaggcgaaacaacgagtgcag
cagttacaactttctaacgttaatctgaaccggatcgcacatttgtgtgcagcatttgac
gtggacggtatgagagctgatttggttatcgctcgaactgcgctagcacatgctgcctgg
cgcggagcttcaatggttgaagatgaggatatccgggtagccgcagagttggccttgcca
catcgccgtcgcagagacccattcgatgagcctggcctagaccaggaacagctggatcaa
gaaatggaaaaagcccgggatcagcaccctgacgccagtgataaagcggaagagcctcag
tgtgaaaaagagcagcatggactagagaacaagtcttcggagactcaatctgagcagccc
accagtgacggtcaggaggaatgcgctactactggcgctccctttcgctccacgggtgct
taa

DBGET integrated database retrieval system