KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1348Help
Entry
Cp162_1348        CDS       T02154                                 

Gene name
trpC2
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cp162_1348 (trpC2)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp162_1348 (trpC2)
Enzymes [BR:cou01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cp162_1348 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1460329..1461138)
Genome map
AA seq 269 aa AA seqDB search
MPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEIKRAA
PDKGVLAEINSPVGLAKELVAGGASLIACQTERRRFHGSLSEMAEIRNVISVPIMCRDFI
VDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRAVAAG
AKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADAVVVG
EKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagtcttcgaagagattattgcgggcgtcattgaagatgtagctgcgcgagaa
tcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgagccgcctcgggat
gcaatagcggcgcttcttaatagtggttgtggtgtgatcgctgagattaaacgtgctgcc
ccagataaaggcgttttagcagagatcaattctcctgttggcttagcaaaagaacttgtc
gccgggggcgctagtttgattgcgtgtcagacggaacgacgaaggttccacggttcatta
tctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgccgagacttcatc
gtggatccctatcaaattcatgaggcgcgctgttatggagcggacatggtgcccttgcgc
gtagccgctttagaccaagccaggatgattgcgcttatagatagaatcgagtccctgggg
atggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcggtggcagcgggt
gcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctcaaccgcctggcc
ttcgcagaaattgctcctggacttcctacagatgttattagagttgcattgtccggtgtg
cgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcggtggttgtggga
gaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttggtggcagcaggc
caacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system