KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1416Help
Entry
Cp162_1416        CDS       T02154                                 

Gene name
glk
Definition
(GenBank) Glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
cou00010  Glycolysis / Gluconeogenesis
cou00052  Galactose metabolism
cou00500  Starch and sucrose metabolism
cou00520  Amino sugar and nucleotide sugar metabolism
cou00521  Streptomycin biosynthesis
cou01100  Metabolic pathways
cou01110  Biosynthesis of secondary metabolites
cou01120  Microbial metabolism in diverse environments
cou01130  Biosynthesis of antibiotics
cou01200  Carbon metabolism
Module
cou_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp162_1416 (glk)
   00052 Galactose metabolism
    Cp162_1416 (glk)
   00500 Starch and sucrose metabolism
    Cp162_1416 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp162_1416 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp162_1416 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cp162_1416 (glk)
Enzymes [BR:cou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp162_1416 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR FGGY_N DEDD_Tnp_IS110 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AFM07748
Position
830495..831448
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIGLVDTLKQKH
EVSAVGLAVAGFLDPDCEVVRFAPHLPWRDRHVRAELSDALGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRTCSCGKRGCL
ERYCSGTALETTAREMIAAGKATESVLIDYLADGSLSGKRIMAAASDGDQLACAVVEDFA
QWMGRALSVVADVLDPGLIMIGGGVSTASALYIDTAVETMAASMVGAGYRPLPTVSCAKL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggcactaacatgcgg
gcggcggcggtgacttcggatggtcagattattgactctatgtcggttcctacgccatca
actcctgaattacttgaatcgggcatcatcgggttggtggataccctgaagcaaaaacac
gaggtttccgcagtaggcctcgccgtagctggcttcttggatcctgattgtgaggtcgtt
cgttttgctccgcaccttccgtggagagatcggcatgtccgtgcagaactttcagatgct
ttagggctacctgtccggcttgagcacgatgcaaattctgctgcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctttttgccgtgggaacaggaattggt
gcaacccttatgcatcaaggagaaatttaccgtggggcttttggcacagcgccggaattc
gggcacctcactgtggtaccaggggggcgaacatgttcctgcggtaaacgaggctgcctt
gaacgctactgttcgggaactgccctggaaactactgcccgcgagatgatcgcggcgggc
aaagcaacagagtccgtgcttatcgactatctagctgatggttccctgagcggtaagcgc
attatggccgcagctagcgacggtgatcagctggcctgcgctgtagttgaagattttgcg
caatggatggggcgagccctatccgtggttgccgatgtccttgatcccggtcttattatg
attggtgggggcgtatccactgcaagcgcgctttatattgatactgctgtggagacaatg
gctgcatcgatggtgggggcaggataccgcccccttcccacagtttcgtgtgcgaagcta
ggcggagatgcgggtatgatcggggtatctgatttggctcgccaattggtttga

DBGET integrated database retrieval system