KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1416Help
Entry
Cp162_1416        CDS       T02154                                 

Gene name
glk
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp162_1416 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp162_1416 (glk)
   00052 Galactose metabolism
    Cp162_1416 (glk)
   00500 Starch and sucrose metabolism
    Cp162_1416 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp162_1416 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp162_1416 (glk)
   00524 Butirosin and neomycin biosynthesis
    Cp162_1416 (glk)
Enzymes [BR:cou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp162_1416 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1531864..1532817)
Genome map
AA seq 317 aa AA seqDB search
MSERSDAVTVGFDIGGTNMRAAAVTSDGQIIDSMSVPTPSTPELLESGIIGLVDTLKQKH
EVSAVGLAVAGFLDPDCEVVRFAPHLPWRDRHVRAELSDALGLPVRLEHDANSAAWGEYR
FGAAQGADNWVLFAVGTGIGATLMHQGEIYRGAFGTAPEFGHLTVVPGGRTCSCGKRGCL
ERYCSGTALETTAREMIAAGKATESVLIDYLADGSLSGKRIMAAASDGDQLACAVVEDFA
QWMGRALSVVADVLDPGLIMIGGGVSTASALYIDTAVETMAASMVGAGYRPLPTVSCAKL
GGDAGMIGVSDLARQLV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaagatccgacgcagtcaccgtgggctttgatattggtggcactaacatgcgg
gcggcggcggtgacttcggatggtcagattattgactctatgtcggttcctacgccatca
actcctgaattacttgaatcgggcatcatcgggttggtggataccctgaagcaaaaacac
gaggtttccgcagtaggcctcgccgtagctggcttcttggatcctgattgtgaggtcgtt
cgttttgctccgcaccttccgtggagagatcggcatgtccgtgcagaactttcagatgct
ttagggctacctgtccggcttgagcacgatgcaaattctgctgcatggggagaatatcgg
tttggtgccgctcagggggcagataactgggttctttttgccgtgggaacaggaattggt
gcaacccttatgcatcaaggagaaatttaccgtggggcttttggcacagcgccggaattc
gggcacctcactgtggtaccaggggggcgaacatgttcctgcggtaaacgaggctgcctt
gaacgctactgttcgggaactgccctggaaactactgcccgcgagatgatcgcggcgggc
aaagcaacagagtccgtgcttatcgactatctagctgatggttccctgagcggtaagcgc
attatggccgcagctagcgacggtgatcagctggcctgcgctgtagttgaagattttgcg
caatggatggggcgagccctatccgtggttgccgatgtccttgatcccggtcttattatg
attggtgggggcgtatccactgcaagcgcgctttatattgatactgctgtggagacaatg
gctgcatcgatggttggggcaggataccgcccccttcccacagtttcgtgtgcgaagcta
ggcggagatgcgggtatgatcggggtatctgatttggctcgccaattggtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system