KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1454Help
Entry
Cp162_1454        CDS       T02154                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cp162_1454 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp162_1454 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cp162_1454 (thrC)
Enzymes [BR:cou01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cp162_1454 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1576854..1578236)
Genome map
AA seq 460 aa AA seqDB search
MGGLAPDGGLYLPEYYPRLDAATLDTWRGILAQQGYAALAAEVLKLFVDDIPAEDLEAIT
ARAYTTPKFSDEEIVPVTKLEDGIYIGHLSEGPTAAFKDMAMQLLGELFEYELLRRKETL
NILGATSGDTGSSAEYAMRGRAGIRVFMLTPKDRMTPFQQAQMFGLDDPNIFNIALDGVF
DDCQDVVKAVSSDAEFKADNHIGAVNSINWARLMAQVVYYISLWLKVTEKSNQKVSFCVP
TGNFGDICAGHIAKQMGLPIDRLIVATNENDVLDEFFRTGEYRVRSAAETLETSSPSMDI
SRASNFERFIFDLLGRDPERCAELFGEQVKAGGFSLAEDDSFEQAATHYGFASGSSTHAD
RIATISDCYTRRGLMLDPHTADGVKVAREWATQIESPIVCLETALPVKFTDTIVEAVGRG
PEIPERFTGILEAQRHVTDLPNDVVAVKNFILKSIARDSA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggtctcgctccagatggtggtttgtatcttcctgagtattacccgcgtctcgac
gctgccaccctagacacctggcgcggcattcttgcccagcaaggctatgcggcgctagca
gcagaagtgcttaagctctttgtcgacgacatcccggctgaggatctagaagctattact
gcgcgcgcttatacaacgcctaagttttccgatgaggaaatcgttcccgtgaccaagctt
gaggatggcatctatataggccacctctctgaggggcccactgccgcatttaaagatatg
gccatgcagctccttggcgagctctttgagtatgagttgctacggcgcaaggaaacttta
aacatcctgggtgctacctctggcgacacaggttcttctgcggaatacgctatgcgcgga
cgcgccggtatccgagtgttcatgcttacccctaaagatcgtatgacgccgtttcagcag
gcccagatgtttggtctagacgatccgaatatcttcaatattgccttagacggtgttttt
gatgactgccaagacgtggtcaaagcggtatcttcagacgcagaatttaaagcagacaac
catatcggcgcagtgaactcaattaactgggctcgcttgatggctcaagtggtgtactac
atttctttgtggctcaaagtaactgagaaaagcaatcaaaaagttagtttctgtgttccc
accggcaattttggtgatatctgcgcagggcatatagctaaacaaatgggattgcccatt
gacaggctcatcgttgctaccaatgaaaacgatgtcctggatgagtttttcagaactggt
gaatatcgtgtgcgttctgcggctgagacccttgagacctcctcgccctcgatggatatt
tctcgggcatccaactttgagcgttttatttttgacctattaggaagagaccccgagcgc
tgcgcagaactattcggggagcaagtaaaggccggcggtttctctctcgcagaggacgat
tcatttgaacaagctgccactcattatggttttgcgtcgggcagctctactcacgcagac
cgcatagccaccatttccgattgttatacgcgccggggcctgatgttggaccctcatacc
gctgatggtgtgaaagttgcgcgcgagtgggccactcagattgaaagccctattgtctgc
ttggaaaccgccctgccagttaaatttacggatactatcgttgaggccgtggggcgtggt
cctgagataccagagcgttttactgggattctcgaggcacaacgccatgtcaccgatctg
cctaatgacgttgttgcggtgaagaactttattctgaaaagcattgctcgggactctgcg
taa

DBGET integrated database retrieval system