KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1560Help
Entry
Cp162_1560        CDS       T02154                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cp162_1560 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Cp162_1560 (proB)
Enzymes [BR:cou01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cp162_1560 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1740979..1742232)
Genome map
AA seq 417 aa AA seqDB search
MENSHDPFGITELTGTGLASSPYTGAASSQGFPELPAEIVDSPAYGHDSPVRERIRAARR
IVVKIGSSSLTNENFQVDPMRIDKLVDALQARMERGSEVIVVSSGSIAAGMGPLGLTQRP
TDLATKQAAASVGQVYLAHAWGTSFGRYGRSIGQVLLTASDAGRRDRARNAQRTINRLLQ
LGTVPVVNENDTVATTGMHFGDNDRLSALVAHLTCADALVLLSDVNGLYDRNPIDPGARF
IHEIRDGNDLKDVAAGDGGRVGTGGMAAKVTAARLASRGGIPVLLTSADSIGAALDSARV
GTVFDPKEDRLSAWKFWVLYTADVAGILRIDAGAVEAVTAGGNSLLAVGITDVEGDFQAG
EIVEIHGPGGEVVGRGEVSVDSATLDALKGLPMSSFPRGQRRAVVHADYLSNYATRA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagccacgacccctttggcatcacggaactcaccggaaccggtttagcgagt
tcgccgtatactggcgccgccagctcccaaggcttcccagaattgccggctgagattgtc
gactcgccggcgtatggacacgattcacctgtgcgtgaacgtatccgtgcggcgcgccgc
atcgtggtaaaaattggcagttcttcgctgacaaacgagaactttcaggtcgacccgatg
cgcatagacaagcttgtcgacgccctccaggcccgcatggaacgcggctccgaggttatc
gtcgtatcttcaggatctatagcagcgggcatggggcccttagggctcacgcagcgcccg
accgacttggccaccaagcaggctgcggcttccgtggggcaggtataccttgctcatgca
tgggggacctcttttggacgatatggtcgttccatcggtcaagtcctacttacagcctca
gacgccggacgccgtgatcgtgctcgcaacgcgcaacgcacaatcaatagacttcttcag
ctggggactgtccctgtggtcaatgagaacgacaccgtggcaaccaccggtatgcacttt
ggcgataatgaccgactttctgctctcgttgctcacctcacctgtgcagacgcattagtt
cttctttcggacgtgaatggcctttatgaccgcaaccccatagaccctggtgcgcgtttt
attcatgaaatccgcgatggcaatgacctcaaagacgtggccgccggcgatgggggacgc
gtaggaaccggtggcatggcggctaaggtcacggctgcgcgtcttgcctctcgtggggga
atcccagttttgcttacctctgcggacagcataggcgcggcattagattccgctcgcgtg
ggaacggtctttgatcctaaggaagaccgcctttctgcctggaaattttgggtgctttat
accgctgacgtggcgggaattttgcgtattgacgccggcgcagtggaggccgtcacagcc
ggcggaaactcactgttggcagtggggatcacagatgttgaaggcgattttcaggcaggg
gagatcgtagaaattcatgggcccggcggagaagtcgtaggacggggagaggtctctgtt
gactccgctacgcttgacgcgcttaaagggcttcccatgtccagcttcccccgtgggcaa
cggcgggctgtggtgcatgcggattacctctctaactatgcgacgcgcgcatag

DBGET integrated database retrieval system