KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1560Help
Entry
Cp162_1560        CDS       T02154                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cou01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cou00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1686487..1687638)
Genome map
AA seq 383 aa AA seqDB search
MPAEIVDSPAYGHDSPVRERIRAARRIVVKIGSSSLTNENFQVDPMRIDKLVDALQARME
RGSEVIVVSSGSIAAGMGPLGLTQRPTDLATKQAAASVGQVYLAHAWGTSFGRYGRSIGQ
VLLTASDAGRRDRARNAQRTINRLLQLGTVPVVNENDTVATTGMHFGDNDRLSALVAHLT
CADALVLLSDVNGLYDRNPIDPGARFIHEIRDGNDLKDVAAGDGGRVGTGGMAAKVTAAR
LASRGGIPVLLTSADSIGAALDSARVGTVFDPKEDRLSAWKFWVLYTADVAGILRIDAGA
VEAVTAGGNSLLAVGITDVEGDFQAGEIVEIHGPGGEVVGRGEVSVDSATLDALKGLPMS
SFPRGQRRAVVHADYLSNYATRA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgccggctgagattgtcgactcgccggcgtatggacacgattcacctgtgcgtgaacgt
atccgtgcggcgcgccgcatcgtggtaaaaattggcagttcttcgctgacaaacgagaac
tttcaggtcgacccgatgcgcatagacaagcttgtcgacgccctccaggcccgcatggaa
cgcggctccgaggttatcgtcgtatcttcaggatctatagcagcgggcatggggccctta
gggctcacgcagcgcccgaccgacttggccaccaagcaggctgcggcttccgtggggcag
gtataccttgctcatgcatgggggacctcttttggacgatatggtcgttccatcggtcaa
gtcctacttacagcctcagacgccggacgccgtgatcgtgctcgcaacgcgcaacgcaca
atcaatagacttcttcagctggggactgtccctgtggtcaatgagaacgacaccgtggca
accaccggtatgcactttggcgataatgaccgactttctgctctcgttgctcacctcacc
tgtgcagacgcattagttcttctttcggacgtgaatggcctttatgaccgcaaccccata
gaccctggtgcgcgttttattcatgaaatccgcgatggcaatgacctcaaagacgtggcc
gccggcgatgggggacgcgtaggaaccggtggcatggcggctaaggtcacggctgcgcgt
cttgcctctcgtgggggaatcccagttttgcttacctctgcggacagcataggcgcggca
ttagattccgctcgcgtgggaacggtctttgatcctaaggaagaccgcctttctgcctgg
aaattttgggtgctttataccgctgacgtggcgggaattttgcgtattgacgccggcgca
gtggaggccgtcacagccggcggaaactcactgttggcagtggggatcacagatgttgaa
ggcgattttcaggcaggggagatcgtagaaattcatgggcccggcggagaagtcgtagga
cggggagaggtctctgttgactccgctacgcttgacgcgcttaaagggcttcccatgtcc
agcttcccccgtgggcaacggcgggctgtggtgcatgcggattacctctctaactatgcg
acgcgcgcatag

DBGET integrated database retrieval system