KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1673Help
Entry
Cp162_1673        CDS       T02154                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine
  KO
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cp162_1673 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cp162_1673 (murA)
Enzymes [BR:cou01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cp162_1673 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:cou01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Cp162_1673 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1882743..1883981)
Genome map
AA seq 412 aa AA seqDB search
MTGGARLEGSVRVSGAKNSVLKLMAAALLAEGTTTLTNCPQILDVPYMIRVLEGLGCSVE
SDNGTVRISTPAEISSDADFDAVRQFRASVCVLGPLTARCGRAVVALPGGDAIGSRPLDM
HQSGLEKLGAKTRIQHGAVVAEAEQLRGAKITLDFPSVGATENILTAAVLADGTTILDNA
AREPEIFDLCTMLKEMGADISGEGTSTITITGVDKLYPTEHEVIGDRIVAGTWAYAAAMT
QGDITVGGIAPRNLHLPLEKLKVAGAEVETYEHGFRVRMNRRPQAVDYQTLPFPGFPTDL
QPMAIGIATVAQGTSVITENIFEARFRFVDELMRLGADATVDGHHVVLRGVEQLSSTPVW
SSDIRAGAGLVLAGLCAEGVTEVHDVFHIDRGYPNFVEDLRRLGATIERVSD
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggtggggcccgactcgaaggctccgtacgagtaagcggcgcaaaaaatagcgtt
ctcaaacttatggcggcagctctgcttgcagaggggacaaccacgctaactaactgtccg
cagatcttggatgttccttatatgatccgagtactcgaagggctggggtgttcggtggaa
tccgataacggaacagtgcgtatcagcacccccgctgagatctctagcgacgcagatttt
gacgccgtacgccaattccgtgcatcagtttgcgtgctcggcccccttacggcgcgctgc
ggtcgagcggttgtggccttaccgggcggagacgccattggaagtcggcctctggatatg
catcagagcggcctggaaaagctcggggctaagactcgtattcagcatggggctgttgtt
gcggaggcggaacagctgaggggagcgaaaattacgcttgatttcccttccgtaggtgca
acggagaacattctcaccgcggcggtgcttgccgacggcaccaccatccttgataacgca
gcgcgagagcccgagatttttgacctgtgcaccatgctcaaagagatgggggccgatatc
tctggtgagggaacctcaacaatcacgatcacgggcgtggataagctgtatcccactgag
catgaagtaatcggcgaccgcattgtcgctggaacctgggcttatgcggcagccatgact
caaggtgacattactgtgggcggtattgcgccacggaaccttcacctgccgttggaaaaa
ctcaaagtagctggtgcggaggtagagacatatgaacacggattccgtgtacgtatgaac
cgccgtcctcaggctgtggactatcaaacattgcccttccctggctttcctaccgatctt
cagccaatggccataggaattgcgactgtggcccaaggaacgtctgtaatcacagaaaac
atctttgaagcgcgtttccgctttgtcgatgagctgatgcggcttggtgcagacgccaca
gttgatgggcaccacgttgttttacgcggggtagaacagttgtcttctactccagtgtgg
agttcggacattagagctggtgccgggttagtcctggccggcttgtgtgctgaaggcgta
actgaggtccatgacgtcttccacatcgatcgcggataccccaattttgttgaagattta
cgacgtctaggtgccaccatcgagcgagtctctgactaa

DBGET integrated database retrieval system