KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1911Help
Entry
Cp162_1911        CDS       T02154                                 

Gene name
nagA
Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cp162_1911 (nagA)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Cp162_1911 (nagA)
Enzymes [BR:cou01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cp162_1911 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2084722..2085798)
Genome map
AA seq 358 aa AA seqDB search
MLAACSDAGTDTDPTSTEATTALTTQETSAPASAKPQPEDVRAKAANLMMVGVSNYDDAL
AALNQGAGGIFIGSGTDPNLLTAPDRNIQALRKAVGRDFSVSIDFEGGRVLRHQGILGTF
PSPQVMAQTMNPEQVRGMAKAMGDSLLAHGVTVNFAPVADIDAGLDVVGDRAFSADPNID
AEYATAFAQGMLDAGVRPVFKHFPGHGRASGDSHTGQVFTPSLGDLENIDLVPYGRINIP
GAGVMLGHMVVPDLGAPQNGLPSTLNPAAYQLLRTGAYRDGRPFAGVVYTDDLAMGAITG
VMPIPQAVVASLQAGADQALWVTTAGLKEAIDATVAAVETGTYPRAQFEESVRRVGVV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgctgcatgtagcgacgccggaaccgatacggatcccaccagcactgaggccacc
actgcgttaacaacgcaggaaaccagcgcgcctgcaagcgcaaaaccacagcctgaggac
gtccgcgctaaagccgcgaacctgatgatggtgggagtaagcaattacgacgacgccctt
gctgccctaaaccaaggcgctgggggtatcttcatagggtccggcaccgatcccaatctt
ctcaccgctccggatagaaacattcaggcgctgcgtaaggccgtggggcgagacttttct
gtctcgatcgattttgagggagggcgtgttctccggcatcagggaattctgggcaccttc
ccctcgccccaagtgatggcacaaaccatgaaccccgagcaggttcgagggatggctaaa
gcgatgggcgactcattgctggctcatggagtgaccgtgaattttgctccggtcgcggat
atagacgctggattagacgttgtgggcgatcgtgcctttagcgcagacccaaatattgat
gcggaatacgccacagcttttgcccaaggaatgcttgatgctggagtccggccagtgttt
aagcacttcccggggcatggccgcgccagtggcgattcacacacaggacaggtattcacg
ccctctttaggtgacctggaaaacattgacctagttccttatggccggattaatatcccc
ggtgccggcgtgatgctcgggcatatggtggttcctgatctaggcgctccccagaacgga
cttccatccactctcaatccggccgcataccagttactacgcactggggcttatcgtgat
gggcgtcctttcgccggcgtggtctacacggatgatcttgctatgggagcaatcaccggg
gttatgcctatccctcaagccgtagtggcctcgctgcaagctggcgcagatcaggctttg
tgggtgaccactgcggggcttaaagaagctatcgacgctaccgtggctgccgtggaaacc
ggcacgtatcccagggctcaatttgaagagtcggtacgccgggttggtgttgtttaa

DBGET integrated database retrieval system