KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_1969Help
Entry
Cp162_1969        CDS       T02154                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cp162_1969 (deoA)
Enzymes [BR:cou01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Cp162_1969 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2161264..2162427
Genome map
AA seq 387 aa AA seqDB search
MAALNMAIFLNGMDREEIVQWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAP
LVASYGVAVPQLSGRGLGHTGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGL
APADKKIYALRDITATVDCIPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQAREL
ARTMVDLGRDAGTNMVALLTDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALAT
EMLELAGVHDPDVHEALADGRAMDSWKKMIRAQGGDPDAALPTARHTHEVTADRDGYLTE
MDALALGVASWRLGAGRARKEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDRFSRA
LESLEPGVNIGDEPPAPRPSVILDRIS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggccgccctcaacatggcaatattcctcaacggcatggacagagaagaaatcgtccag
tggacccaggccatgatcgactccggcgagaccatgagctttgccagtctctcccggccc
acaacagacaagcactccaccggcggggtcggcgataaaatcacgcttccacttgcgcca
ctcgttgccagttacggcgttgccgtgccacaactctctggtagaggactaggacacaca
ggcggaaccctagacaaattagaggccatccccgggtgggaagctgacatagataatgcc
cgaatgatgaagatcctcgaagaccccggctgcgtggtatgcgccgcgggagcaggcctc
gcacccgccgacaagaagatctatgcgctgcgtgacatcactgccaccgtcgactgcatc
ccactgatcgccagctccatcatgagtaaaaaaatcgccgagggaaccgcaaacctagtc
ctcgacgtcaaggtgggttccggggcctttatgaaggagcttgaccaggcccgcgagctc
gcccgcaccatggttgacctgggtcgcgacgccggaaccaatatggtcgcgcttctcacc
gacatgtccgtccccctggggcgcaccatcggcaatgccctagaagttcgcgagtctgta
gaggtcctcgcaggtggcggcccttccgacgtcatagagctcacctgcgcccttgcgacg
gagatgcttgagctcgccggtgtccatgatcccgatgttcacgaagcgcttgccgacggc
cgcgcgatggactcttggaagaagatgatccgcgcgcagggcggcgaccccgacgcagcg
ctccccaccgcacggcacacccatgaggtcaccgccgatcgcgacggctatctcacagag
atggacgccctagcgctgggagtagccagctggcgactcggcgcaggacgcgcacgcaag
gaagatccagtccaactcggcgcaggcatcgagatccatgcagagctcggcgagaaggta
tcaaagggccagaagcttttcaccctccacaccgacgatgaggaccgtttcagccgagcc
ctagaatccctcgaacccggcgtaaatatcggcgatgagcccccggcacctcgcccctcg
gtcatccttgatcgcatcagctaa

DBGET integrated database retrieval system