KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_2051Help
Entry
Cp162_2051        CDS       T02154                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp162_2051
Enzymes [BR:cou01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Cp162_2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2251035..2251736)
Genome map
AA seq 233 aa AA seqDB search
MPEDRGHLISASTSACGEILFMSSIPDMTLGGSIRGGVPIIAPWFGKLMGHKELQHGWAR
RQKWEVLETSGGLDARMSHDDWDLRLAVQSTPRGFAMMLKCRNASSVCRKLQLAFHPYFY
VSDVLDTTVTAPGETFTTDGGLLEEFRLSAPTPLLIDDGQRLITVKGQGTDHFIVWNPGE
KLASEMSDMGTGEWRNFVCVEPALLGEDSEGVSVAPWDWVQIGMTVQVEAISR
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagatcgcggccaccttatctctgccagtacctctgcctgtggtgaaatactc
tttatgtccagcattccagatatgacgctggggggttccattcgtggtggtgtgcccatt
attgctccgtggtttggcaaacttatggggcacaaggagctgcaacatggatgggcgcgc
cggcagaaatgggaggtgctagagacctcgggtgggctcgacgctcgaatgagtcatgat
gattgggacttgcgtttggcagtccagtcgacgccgcgaggttttgccatgatgctgaaa
tgtagaaacgcctcaagcgtttgccggaagcttcagttggcgttccatccatatttttat
gtctctgacgttcttgataccaccgtgaccgcccccggagagacctttactacggacggt
ggtttgttggaggaatttcgcctctccgctcccacgcctctgcttatcgacgacggccag
cggctcattaccgttaaagggcaagggactgatcactttattgtgtggaaccccggcgag
aaactggcgagtgagatgtccgatatgggcactggggaatggcgaaactttgtctgtgta
gagcccgctctcctaggggaagactccgaaggggtttcggtggcgccgtgggattgggta
cagattggtatgactgtgcaggttgaagcgatttctaggtga

DBGET integrated database retrieval system