KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_2064Help
Entry
Cp162_2064        CDS       T02154                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cou01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cou00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2265730..2267217
Genome map
AA seq 495 aa AA seqDB search
MQNNVPMPTVLEEIVNTRRSRIQEISARISHINPLQLPRSTKSLFQALGGSINGGAASRR
QAYSNASTRAPHFIMECKSASPSLGTIRTDYSPGDIARIYSRYASAISVLCEPDKFNGDY
DHLATVAASTHLPVLCKDFIVDPVQIQAARYFGADAVLLMLSVLDDATYLSLSSEAERLG
LDVLTEVINEEEAKRGIRLGAKIFGVNHRNLHDLSIDLSRSSQLEPLIPENAVLVSESGI
KTNETVRQLAGHSDAFLVGSQLTSHSNIDSASRSLVYGTNKVCGLTTASAAQNARAVGAT
HGGLIFENSSPRNVSRETAEKIIAAEPNLNYVAVSRRDHGWEEILLPEITSLQIHAPYQG
SIAGERALIDNARRELQKAGREDVSIWRAVSMTLPEGAATATALTGDVDMLLLDAGIGGT
GTSFNWEKITPDIAPNAILAGGLNLDNLPEALKAGCAGLDLNSGFEYPSTTGSWSGMKDS
GLLRQAFSKIRNFHY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaataatgtgcccatgcccacagtcttagaagaaatcgttaatacgcgaagatca
cgcatccaagagatcagcgcgcgcatttcacatataaacccgctccagctaccgaggtcc
acaaagtccctttttcaggcgcttggaggttctatcaacgggggagcagcgtcgcgtcgt
caagcttattccaacgcatccaccagagcaccgcactttattatggaatgcaaatctgca
tcaccatcattaggcacaatccgtaccgactattccccgggagatattgcacgcatttat
tctcgatatgcttccgcaatttccgttctttgtgaacccgacaagttcaacggcgactac
gaccacttggccactgtcgcggcttccacgcatttgccggtcttatgcaaggactttatc
gtcgaccctgtgcagattcaggctgctcgttactttggcgcggacgcggtcttgctcatg
cttagcgtgcttgacgacgccacctacctctcactttctagcgaagccgaacgtctcgga
ctcgatgtactcaccgaagtgataaacgaagaagaagcaaaaaggggtattcgtctcggg
gctaagatatttggcgttaatcaccgcaacctacacgatctcagcatcgacctttcccgc
tcctcacagctagagcctctcattccagaaaacgccgtattagtatcagaatctggcatc
aaaacaaatgagaccgttagacaactagctggacattccgacgctttccttgtgggctcc
cagctcaccagccacagcaacattgattccgcctcccgttcactcgtttacggaaccaat
aaggtatgcggtctcaccacggcttccgcagcacagaatgctcgcgcagttggcgcaaca
cacggggggctaatttttgaaaactctagcccccgcaatgtttcacgtgaaaccgccgaa
aaaatcattgcagcggagcccaacctgaactacgttgcagtgagcagacgcgaccatgga
tgggaggaaatacttcttccagaaattacgagtctccaaatccatgccccataccaggga
tccatagcaggggagagggcgctcatcgataatgcccgccgggagcttcaaaaagcggga
agggaagatgtctccatctggagagctgtgtccatgacacttccagagggggccgccacc
gctaccgcactgacgggtgacgtagatatgttgcttctcgacgccggcattggaggcacc
ggaacatcgtttaattgggaaaaaatcacgccagatatagcccctaacgcgatcctggca
ggaggtcttaacctggacaatcttcctgaagccttaaaggcaggatgtgccggcctggat
ctcaattctggtttcgagtacccatccaccactgggtcgtggtctgggatgaaagattcc
ggattgctacggcaagcgttctccaagatccggaattttcattattag

DBGET integrated database retrieval system