KEGG   Corynebacterium pseudotuberculosis Cp162: Cp162_2066Help
Entry
Cp162_2066        CDS       T02154                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cou  Corynebacterium pseudotuberculosis Cp162
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cou00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cp162_2066 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp162_2066 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp162_2066 (trpB)
Enzymes [BR:cou01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp162_2066 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2267612..2268862
Genome map
AA seq 416 aa AA seqDB search
MTLSYNETTQQTLLPAYFGEFGGQFVPESLLPALDQLEKAFVEAQEDPHFRKELAGYLKD
YLGRPTPLTECSKLPLQGKGKGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKKRII
AETGAGQHGTATALACALLNLECVIYMGAKDVERQQPNVYRMELMGATVVSVDSGSGTLK
DAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQMLERTGGLPDVV
VACVGGGSNAIGMFADFIENASVELVGAEPGGEGLSSGKHGATINNGRIGILHGAKSYLM
RNSDGQVEESYSISAGLDYPGVGPQHAHLSQSGRATYVAITDAEALEAFQLLSREEGIIP
ALESSHALAYALKRAALAEEEGKNITILVSLSGRGDKDIDHIRKTLAANPELSLKD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcttacaacgaaaccactcagcaaacactccttcctgcatactttggggag
ttcggcggacagtttgtccccgagtcactccttccagcgcttgatcagcttgaaaaagct
tttgtcgaggcccaagaggacccacactttcgcaaagaactagcgggctatctcaaagac
tatttgggaagaccaactccattaacggaatgctccaagctacctttacagggaaaaggt
aagggatatgcgcgcatcttccttaaacgcgaagaccttgttcacggtggagcacataaa
acaaaccaagttatcggccaggctcttttagctaagaggatgggtaaaaagcgcatcatc
gcagaaactggtgccgggcaacatgggacagcaaccgctcttgcatgcgcacttttaaac
ctcgaatgcgtcatttacatgggagctaaagacgtggaacgtcaacagcccaatgtgtat
cgcatggagcttatgggagctactgtggtgtccgtagattcaggttccgggacactcaaa
gatgcggttaatgaggccctgcgcgattggaccgcaacgttccacgaatcccattatctg
ctcggtacagcagccggacctcatccgtttcccacgatcgtccgagaatttcatcgtgtc
atttcagaggaagctaaagcacaaatgcttgagcgcaccggcggactcccggatgttgtg
gttgcttgcgtgggcggaggctccaacgcaataggtatgtttgcagacttcattgagaat
gcatctgtagaactcgttggtgcggaacccggcggtgagggattatcgtccggaaagcac
ggtgcaaccattaacaatggacgtatcggtatcctgcacggcgccaaaagctatttgatg
cgaaattctgacggtcaagtggaagaatcctattccatttccgccgggctggattatccc
ggagtcggtccacagcacgcgcacctatcgcagtctgggcgagccacctatgtggccatc
acagatgccgaggcgcttgaagccttccaattactttcccgtgaagagggaatcattcca
gcattagagtccagccacgccctcgcatatgcgttgaaaagagctgccctcgcggaggaa
gagggtaagaatatcaccatattggtctccctttcagggcgtggcgataaagacatcgat
cacattcgcaagactctagctgccaaccccgagctttccctcaaggactaa

DBGET integrated database retrieval system