KEGG   Caldicellulosiruptor owensensis: Calow_0317Help
Entry
Calow_0317        CDS       T01347                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Calow_0317
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Calow_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
375367..376305
Genome map
AA seq 312 aa AA seqDB search
MSDICVLGSVNMDVVIKVDDMPAVGETIKAKEIKKICGGKGANQAVAVARLGGNVSFIGC
IGKDENGEILLETLKREKIDTKTIRLDDNLPTGVAYIIVDKKGKNLILVYSGMNSDLNEN
DVYNNKEVIANSKILISQLEIPINTVIKAFKIAKENKVITILNPSPVSDIPDELYRLCDI
IIPNEMEAERLTGIYPATLSDIEKIGEFFYHKSIKISIITLGERGSAVYYNGKINIVPSI
QVNVIDTTAAGDTFIGAFAWQLSKTDELTFEKLCKIVELANKVAAISVTKEGAQSSIPYL
SEVIGMYGSVDI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatatttgtgtactgggtagtgttaatatggatgtagttataaaggttgatgat
atgcctgcagtcggggagaccataaaagcaaaagaaataaaaaagatttgtggtggtaaa
ggtgcaaatcaagctgttgctgtggcacggcttggtggaaatgttagtttcattgggtgc
ataggaaaagatgaaaatggcgaaatattattagaaaccctgaaaagagaaaaaattgat
acaaaaactataagattggatgataatttacctactggtgttgcttatatcattgtagac
aaaaaaggaaaaaatttgatattagtttattcaggaatgaatagtgatttgaatgaaaat
gatgtatataacaacaaagaagtaatagccaactcaaaaatattaatttctcaattggag
attccaatcaatacagtaattaaagcattcaaaatagctaaagaaaataaagtaataacc
attttaaatccttctccagtaagtgatatacctgatgaactttacagattatgcgatata
ataattccaaatgaaatggaagcagaaaggttaacaggtatatatccggcaactttgagt
gatatcgaaaagattggagagtttttctatcacaagagcataaaaatttcaattataaca
ttaggtgaaagaggttcagctgtatattataatgggaagattaatatagtaccgagcatt
caagttaatgttatagatactacagcagctggagatacttttataggtgcatttgcttgg
caattgtcaaaaactgacgagttgacttttgaaaaattatgcaaaatagtggaattagct
aataaagtggcagcaatttcagttacaaaagagggagctcaatcatcaattccttatctc
tcagaagtaataggtatgtatgggagtgttgatatatga

DBGET integrated database retrieval system