KEGG   Caldicellulosiruptor owensensis: Calow_0322Help
Entry
Calow_0322        CDS       T01347                                 

Definition
carbohydrate kinase, FGGY-like protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Calow_0322
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Calow_0322
Exosome [BR:cow04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calow_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
380368..381843
Genome map
AA seq 491 aa AA seqDB search
MAYILVIDQSTSATKAIIFDEKANIVKRSNVYHKQIYPRPGWVEHDPEEIYNNTVLAIKT
VLNESEVDPSEIIALGITNQRETALVWDKTTGKPVYNAVVWQCKRGEEICERIRSEETEE
VIKKKTGLKLSPYFSAAKVKWILDNLNETYNRNNLLFGTIDCWLVWKLTKGESYATDYSN
ASRTQLFNIVDLKWDEELFSLFGIDLIEKPKVLCSDEIFGYTTAEGIFPKPIPICGVIGD
SQGALFGQGCWSEGDIKATYGTGSSIMMNTGERVVISDKLSTSIAWGFGGKVSYVIEGNI
NFSGATLKWLAENLELIGSVKECSNIAKQVKSTDGVYFVPAFTGLASPYWNSRAKAAIVG
MNVDTKKAHIVRAAEESMAYQVRDIIEAVKEVFPTNIYKLNADGGPTKDEFLMQFQADIL
GIPVCVNNLEEVSALGAMLMAGFGIKMWHKHSEVLNLIKHDRVYINNMDEITREQLYRGW
KRAVDSVLINS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
ttggcatatattctggttattgaccagagcacatcagctacaaaagcaattatatttgac
gagaaagctaatattgtaaaaaggagcaatgtatatcacaaacaaatttatccaagacct
ggttgggtagagcatgaccctgaagaaatatataataatactgtattagcaataaaaacg
gttttaaatgagagtgaagtagatccttcagaaattatagcattgggtataacaaatcaa
agagaaacagctttggtatgggataagactacaggaaagcctgtatataacgcggttgta
tggcagtgcaaaagaggagaagagatttgtgaaaggatacgttctgaggagacagaagaa
gtaataaagaaaaagacgggattaaaattatcaccatacttttcagcagcaaaagtaaag
tggatacttgataatttaaatgagacttataataggaataatctgttatttggtactatt
gattgctggcttgtgtggaagctaacgaagggagaaagttatgcaacagattattccaat
gcgagcaggactcagctttttaatattgtagatttaaaatgggatgaagaactattttct
ttatttgggattgacttaatagaaaagcctaaagtattgtgttcagatgaaatttttggc
tatacaacagctgaagggatatttccaaagccaattccaatttgtggtgttataggggat
tcacagggtgcattatttgggcaaggatgctggagtgaaggtgatataaaagcaacatat
ggaacaggttcttcaataatgatgaatacaggggaacgagttgttatttcagacaagctt
tcaacttcgattgcgtggggatttggtgggaaggtaagttatgtaatagagggtaatata
aacttttctggtgctacattaaaatggttagcagagaatttagaactcattggaagtgtt
aaggaatgttcaaacatagctaagcaagtaaaaagtacagatggcgtttattttgtacct
gcatttacaggattggcatcaccgtattggaacagcagagcaaaagctgcaatagtaggt
atgaatgtcgatactaaaaaagcacatatagttcgagcagcagaggaatcgatggcttat
caagtgagggatataatcgaagctgtaaaagaagtatttcctactaatatttataaatta
aatgctgatggtggaccgacaaaagatgaatttttaatgcagtttcaagctgatatatta
gggataccagtatgtgtaaataatcttgaagaagtgtcagcacttggcgcgatgttaatg
gcgggatttggtataaaaatgtggcataaacatagtgaagtgttgaatttaataaaacat
gaccgtgtatatataaacaatatggatgaaattacaagagagcaactctacagaggttgg
aaaagagcagttgatagtgttctgattaattcataa

DBGET integrated database retrieval system