KEGG   Caldicellulosiruptor owensensis: Calow_0333Help
Entry
Calow_0333        CDS       T01347                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Calow_0333
  Lipid metabolism
   00561 Glycerolipid metabolism
    Calow_0333
   00600 Sphingolipid metabolism
    Calow_0333
Enzymes [BR:cow01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Calow_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395684..397873
Genome map
AA seq 729 aa AA seqDB search
MPITFNPQTNMFFIEAKNTSYVIKLFKGKFLSHVYWGKRIREFEWTDFDVTGGRVFGPTP
DPHDKSYTFDTMLLEYPAYGNSDFRHPAYQVQQEDGSRITNLVYKAHRIYDGKPKLEGLP
ATYVESSDEAQTLEIDLYDDLIDLKVTLIYTAFRDYDAITRSVRFENLGKQKLKILRAMS
ACVDFSEGDFELLHLWGAWARERYIERKEIIHGQQIIESSRGESSHQHNPFIALVRKDAN
EDYGDVYGFSLVYSGNFAAIVEKDQYNCVRVTMGINPFEFTWVLEPHSSFQTPEVVMVYS
DEGLGKMSRTYHKLYRKRLCRGVWRDRRRPVLINNWEATYFDFNEEKLLTLAKEAKELGI
ELFVLDDGWFGKRDDDTSSLGDWFVDKRKLPDGLDGFGKKLNEMGLKFGLWFEPEMVSPE
SELYRKHPDWCLQVKGRTLTQGRNQYVLDITREDVRKEILRMMKEILKTAPIEYIKWDMN
RPLTEAYSLALPPERQKEVFHRYVLGLYQMMEELTTEFPHILFEGCSGGGGRFDPGILYY
MPQIWTSDDTDAIERLKIQFGTSIVYPASTMGAHVSIVPNHQVGRITPMKTRGVVALSGA
FGYELDLTKLSPEDKEEIKRQIETYKEIWHIVFEGELFRLISPFEENAAAWMFVTEDKSE
AVVFYVEVLKTPNKHPRRLKLKGLLPDKKYLIKELNTSKFGDELMNLGIFIPEMWGDFNS
KMWTLKALD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccaataacctttaacccacaaacaaacatgtttttcatagaagctaaaaacacgagc
tatgttataaagcttttcaaaggaaagtttttatcccatgtttactggggcaaaagaatt
agagaatttgaatggacagactttgatgtgacaggtggaagggtgtttggcccgacccct
gacccacacgacaaatcttatacttttgatacaatgcttttagaataccctgcgtatggc
aactcagatttcaggcaccctgcatatcaagttcagcaagaagatggttctcgtataaca
aaccttgtttataaggctcacagaatctatgatggaaaaccaaaacttgaaggacttcct
gcaacatatgtagagtcatctgatgaggctcaaacactggaaatagacctttatgatgat
ttgattgacttaaaagtcacactgatatatacagctttcagagattatgatgcgataaca
agaagcgtaagatttgagaacttgggaaaacaaaagctcaaaattcttcgtgcaatgagt
gcgtgtgttgacttttcagaaggggattttgaacttttacatctgtggggggcttgggca
agggaaaggtatattgaaagaaaagagattattcatggtcagcagattatagaaagttca
agaggtgaaagttctcatcagcacaatccattcatagctcttgttagaaaagatgcaaat
gaagattacggagatgtgtatggtttttctcttgtctacagtggaaattttgctgcaatt
gtcgaaaaagaccagtacaattgtgtaagagtcactatgggaataaatccatttgaattt
acatgggttttagaaccgcatagtagctttcagacacctgaggttgtaatggtatattca
gacgaaggtttgggaaagatgtctcgcacgtaccataagctttacagaaaaagactttgc
aggggtgtttggagagatagacgaagacctgtgcttatcaataactgggaagcaacgtat
tttgatttcaatgaagaaaagcttttaactttggcaaaggaagcaaaagaacttggcatt
gaactttttgttcttgacgatggatggtttggcaagagagatgatgatacaagctcgctt
ggcgactggtttgttgataaaagaaaattaccagatggtttggatggttttgggaaaaaa
ttaaatgaaatgggtcttaaatttggactttggtttgaacctgagatggtctcgccagag
agtgaactttacagaaagcatcctgactggtgtttgcaggttaaaggcagaacccttacc
caaggtagaaatcagtatgtgttagacataacaagagaagatgtaagaaaagaaatttta
aggatgatgaaagagattttgaaaacggctccaattgaatatatcaagtgggacatgaat
agacctttgacagaggcttattctcttgctcttccaccagagagacaaaaagaagtcttc
catagatatgttttaggactatatcaaatgatggaagaattgacaacagaatttcctcat
attttatttgagggatgttctggcggtggtggaaggtttgatcctggaattttatattac
atgcctcagatttggacaagtgacgatacagatgcaatagaaaggttaaagattcagttt
ggaacaagcatagtatatcctgcatcaacaatgggggcgcatgtgtcaattgtgccaaac
catcaggttgggagaataaccccaatgaaaacaagaggagtggttgcattatctggtgct
tttgggtatgagcttgacctgaccaagctttctccagaagataaagaagagattaaaaga
cagatagaaacttacaaagagatttggcatatagtatttgaaggagaacttttcagatta
atctctccatttgaagaaaatgcagctgcctggatgtttgtaactgaagacaaaagcgaa
gctgttgtattttatgttgaggttttgaaaactccaaataaacatcccagaagattaaaa
ttaaaaggtcttttgcctgataaaaaatatttgattaaagaacttaatacatcaaaattt
ggcgatgagcttatgaatcttggtattttcattccagagatgtggggagattttaattca
aagatgtggacattaaaagcacttgattag

DBGET integrated database retrieval system