KEGG   Caldicellulosiruptor owensensis: Calow_0407Help
Entry
Calow_0407        CDS       T01347                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
cow00010  Glycolysis / Gluconeogenesis
cow00052  Galactose metabolism
cow00500  Starch and sucrose metabolism
cow00520  Amino sugar and nucleotide sugar metabolism
cow01100  Metabolic pathways
cow01110  Biosynthesis of secondary metabolites
cow01120  Microbial metabolism in diverse environments
cow01130  Biosynthesis of antibiotics
cow01200  Carbon metabolism
Module
cow_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_0407
   00052 Galactose metabolism
    Calow_0407
   00500 Starch and sucrose metabolism
    Calow_0407
   00520 Amino sugar and nucleotide sugar metabolism
    Calow_0407
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calow_0407
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Calow_0407
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Calow_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Peptidase_M22 DEDD_Tnp_IS110 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADQ03993
UniProt: E4Q3V8
Position
469287..470237
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGSVPTGAHRHYTEILKDMAELSLNLVKECGLSL
EDIHSVGIGSPGAPDNEKGMILYSNNIAFLNVPMRDEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTRISVTITLGTGIGGGIIIDGRIYTGSHHAGAELGHMVICVDGEQCTCGRKGC
WEAYASATALIRMTREAAAKNLNGTIMKLVNGDISKIDAKTAFDAKRMGDSIGAAIVDKY
VKYLAEGLANICNIFEPEVICIGGGVSKEGEYLLEPVRKLVYEKFYCKQVPMPKIIPAVL
GNDAGIIGAALLAKQL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacataggaattgacttgggaggcacaaacattgcagcagggattgttgatgag
gaaggaaaaatcataaaaaagggctctgttccaacaggggcacataggcactacacagag
atattaaaagacatggcagagctaagtttaaatcttgtaaaagagtgtgggctttcttta
gaggatattcactctgttgggattggaagcccgggtgcgcctgacaatgaaaagggaatg
attttatatagcaacaacattgcttttttaaatgttcctatgagagatgagatacaaaaa
tacattccaaagcctgttaacatagaaaacgatgctaactgtgcggcatatggtgagtat
atagcaggcggtgcaaaaggcacaaggatttctgttacaatcacattgggaactggcatt
ggcggtggaattataattgatggcagaatttacacaggttcgcaccatgcaggtgctgag
cttggacacatggtgatttgtgttgatggcgagcagtgtacatgtggaagaaaagggtgc
tgggaagcgtatgcgtccgcaacagctttgattcgtatgacacgtgaggctgcagcaaaa
aatttaaatggtactatcatgaagcttgtaaatggcgatatttctaaaattgatgcaaaa
acagcttttgatgcaaagcggatgggagacagcattggtgcagcaattgttgataaatat
gtgaaataccttgctgagggccttgcaaacatctgcaatatatttgaaccagaggttata
tgtattggcggtggggttagcaaagaaggagagtatcttttagagcctgtgagaaagctt
gtgtatgaaaaattctactgcaaacaggttccaatgcccaaaattattcctgccgttttg
ggaaatgatgcaggtataattggggcagctcttttagcaaagcagctatga

DBGET integrated database retrieval system