KEGG   Caldicellulosiruptor owensensis: Calow_0407Help
Entry
Calow_0407        CDS       T01347                                 

Definition
glucokinase, rok family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calow_0407
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_0407
   00052 Galactose metabolism
    Calow_0407
   00500 Starch and sucrose metabolism
    Calow_0407
   00520 Amino sugar and nucleotide sugar metabolism
    Calow_0407
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calow_0407
   00524 Butirosin and neomycin biosynthesis
    Calow_0407
Enzymes [BR:cow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Calow_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
469287..470237
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGSVPTGAHRHYTEILKDMAELSLNLVKECGLSL
EDIHSVGIGSPGAPDNEKGMILYSNNIAFLNVPMRDEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTRISVTITLGTGIGGGIIIDGRIYTGSHHAGAELGHMVICVDGEQCTCGRKGC
WEAYASATALIRMTREAAAKNLNGTIMKLVNGDISKIDAKTAFDAKRMGDSIGAAIVDKY
VKYLAEGLANICNIFEPEVICIGGGVSKEGEYLLEPVRKLVYEKFYCKQVPMPKIIPAVL
GNDAGIIGAALLAKQL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacataggaattgacttgggaggcacaaacattgcagcagggattgttgatgag
gaaggaaaaatcataaaaaagggctctgttccaacaggggcacataggcactacacagag
atattaaaagacatggcagagctaagtttaaatcttgtaaaagagtgtgggctttcttta
gaggatattcactctgttgggattggaagcccgggtgcgcctgacaatgaaaagggaatg
attttatatagcaacaacattgcttttttaaatgttcctatgagagatgagatacaaaaa
tacattccaaagcctgttaacatagaaaacgatgctaactgtgcggcatatggtgagtat
atagcaggcggtgcaaaaggcacaaggatttctgttacaatcacattgggaactggcatt
ggcggtggaattataattgatggcagaatttacacaggttcgcaccatgcaggtgctgag
cttggacacatggtgatttgtgttgatggcgagcagtgtacatgtggaagaaaagggtgc
tgggaagcgtatgcgtccgcaacagctttgattcgtatgacacgtgaggctgcagcaaaa
aatttaaatggtactatcatgaagcttgtaaatggcgatatttctaaaattgatgcaaaa
acagcttttgatgcaaagcggatgggagacagcattggtgcagcaattgttgataaatat
gtgaaataccttgctgagggccttgcaaacatctgcaatatatttgaaccagaggttata
tgtattggcggtggggttagcaaagaaggagagtatcttttagagcctgtgagaaagctt
gtgtatgaaaaattctactgcaaacaggttccaatgcccaaaattattcctgccgttttg
ggaaatgatgcaggtataattggggcagctcttttagcaaagcagctatga

DBGET integrated database retrieval system