KEGG   Caldicellulosiruptor owensensis: Calow_0413Help
Entry
Calow_0413        CDS       T01347                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Calow_0413
Enzymes [BR:cow01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Calow_0413
Exosome [BR:cow04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calow_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(477276..479222)
Genome map
AA seq 648 aa AA seqDB search
MIKKVKSTIYLSDIKKFESGEHFESYKFLGSRVVNYRGKVGTVFCVWAPNAKSVSVVGNF
NNWCGENHKMMRVYGSGFWWLFVEGIGEGELYKYEIIGADGKRVLKADPYAIYSELRPNT
ASIVKNIPDYEWHDQEWMEKRNTTVPYDKPINIYEVHLASWKMKKDGSIEKAGEFYNYRE
LAHMLVDYLKEMNYNYIELLPVLEHPLDMSWGYQPTGYFSLTSRYGDIEDFMYFVDFMHQ
NGIGVIVDWVPAHFCKDEHGLYRFDGTFLYEYENELLRENYTWGTATFDFSKPQVQSFLI
SSAMFWFDVYHIDGIRVDAVSHIIYMNNNQKNRYGGHENIEGIEFIKKLNCAIFSKYPNV
LMIAEESTAFPLVTYPTYDGGLGFNYKWNMGWMNDTLKYMQKHPDERKHHHNLLTFSIMY
AFSENFILPFSHDEVVHGKKSLLDKMPGDYNQKFANLRLLYGYMYTHPGKKLLFMGGEFG
QFIEWRFYASLDWLLLDYPMHRMLQHYVKTLNRFYLENKALWELDHKMDGFRWIDVHNWQ
QSIISYLRFSKDPDDFLVVICNFGLASYENYKIGVPRKGMYLEVFNSDKAEFGGNNIVNT
EKLKTIDEVWHGYNQCIEFRLPALSCLIFKPVEFFNNQEEKEQYDNNI
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagtaaagtctactatttatctatctgatataaaaaaatttgaatcagga
gagcattttgaaagttataagtttttgggaagcagggtggtaaactacagaggcaaggtt
ggaacagttttctgtgtgtgggcaccaaatgctaaaagtgtatctgttgttggaaatttt
aataattggtgtggcgaaaatcacaagatgatgagagtttatggtagtggcttttggtgg
ctgtttgtagaaggtattggcgaaggagaactttacaaatatgagattatcggcgctgat
gggaaaagggttttaaaagctgacccgtatgcaatttactctgagcttcgtcccaataca
gcatcaattgtcaaaaatattccagactatgaatggcatgatcaggaatggatggaaaaa
agaaatacaactgtgccatatgacaagcctattaatatttatgaagtacatttagcctca
tggaaaatgaaaaaagacggaagtatagaaaaagctggcgaattttataactaccgagaa
cttgctcatatgcttgtagactatttaaaagaaatgaattacaactacatagaacttttg
ccggttttagaacaccctcttgacatgtcatggggttatcaaccaacaggatatttttct
ctaacatcacgctatggagatattgaagattttatgtattttgttgattttatgcaccaa
aatggaatcggagtaattgttgactgggtaccagctcatttttgcaaagatgagcatgga
ctttacagatttgatggaacatttctatatgaatatgaaaatgaacttttaagggaaaac
tacacatggggaactgccacatttgatttttcaaaaccacaggtacaaagctttcttatc
tcaagtgcaatgttctggtttgatgtatatcacattgacggaataagggtagatgctgtt
tctcatatcatctacatgaataacaaccagaaaaatagatatggcggacatgaaaacata
gaaggaattgaatttataaaaaagctaaattgtgcaatattttcaaaatatccaaatgtc
ctgatgattgccgaagagtcaactgcatttcctctggtcacatatccaacatacgacgga
gggcttggctttaactacaagtggaacatgggatggatgaatgacacattaaagtatatg
caaaaacatccagatgagagaaaacatcatcacaaccttttgacattttctataatgtat
gcattttctgaaaactttattctgccgttttcacacgatgaggttgtccatggaaaaaaa
tctttgcttgacaagatgccaggtgattataaccagaaatttgcaaatttgagacttctt
tatggctatatgtacacacatccgggcaaaaaacttcttttcatgggtggtgagtttggt
cagttcattgaatggagattttatgcatcacttgactggctgcttttggactatcctatg
caccgcatgcttcagcactatgtcaaaacattaaacagattttacttggaaaacaaagct
ctctgggaactcgatcataaaatggatggttttagatggatagatgttcacaactggcaa
cagagcatcatctcatacctgagattttcaaaagaccctgatgattttcttgttgtcatt
tgtaattttggtcttgcttcatatgaaaattacaaaataggtgtgccaagaaagggtatg
tatttggaagtatttaacagtgataaagctgaatttggtggtaataatatagtaaacaca
gaaaaacttaaaacaattgatgaagtatggcatggatataatcagtgcatagaattcagg
cttcctgcactttcgtgtttgattttcaaaccagttgaatttttcaacaatcaagaagaa
aaagagcaatatgacaacaacatttaa

DBGET integrated database retrieval system