KEGG   Caldicellulosiruptor owensensis: Calow_0459Help
Entry
Calow_0459        CDS       T01347                                 

Definition
glycoside hydrolase family 5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Calow_0459
Enzymes [BR:cow01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Calow_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525624..527327
Genome map
AA seq 567 aa AA seqDB search
MKKIILKSCVLLLMAIFTISILQILNVFAQSMPYEKEEYPHLLGNQAVKKPSVAGRLQII
EKDGKKYLADQKGKIIQLRGMSTHGLQWYGDIINKNAFEALSKDWECNVVRLAMYVGEGG
YASNPNLKEKVIEGIKLAIENDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIATSFPNDY
HIIYELCNEPNSNEPGVENSLDGWKKVKAYAQSIIKMLRSMGNQNIIIVGSPNWSQRPDF
AIQDPINDKNVMYSVHFYSGTHKVDGYVFENMKKAFENGVPIFVSEWGTSLASGDGGPYL
DEADKWLEYLNANYISWVNWSLSNKNETSAAFVPYISGMHDATSLDPGDDKMWDIKELSI
SGEYVRARIKGVTYEPVRRDIGMKCPFKDVSEDNIFYEHVVKLYSKGIIKGTSSSKYLPD
KNITRAEFAALCVRALNLEIEKYDGSFSDVKSDTWYSDVVYTAYKNGLFGQEKNRFFPER
IMKREETAALAIEVYKRLTGKIEVDTDDIQIADEELIDPQYRESVKLAVQLGIIDLVSDG
TFAPDKSVSRGEAATIMYNILNLSGKL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattttaaaatcatgtgtactccttttgatggctatttttactatttct
atattacagattttgaatgtatttgctcagagtatgccttatgaaaaggaagaatatccc
caccttcttggtaaccaagcggtaaaaaaaccatcagttgctggcaggctccagattatt
gaaaaggacggtaaaaagtatttagctgaccagaaaggcaaaataattcagcttcgtggt
atgagtacgcatggacttcagtggtatggtgatattataaacaaaaatgcatttgaggct
ctttcgaaagattgggagtgcaatgttgtaaggcttgcgatgtatgtgggcgaaggtggc
tatgcttcaaatccaaaccttaaagaaaaagttatagaggggattaaacttgcaattgaa
aatgacatgtatgtgattgttgactggcatgtgttaaatcccggcgacccgaatgctgaa
atttataaaggggcaaaagactttttcaaggagatagctacaagttttcccaatgactat
cacataatatatgaactttgtaatgaaccgaattcaaatgagccgggagtagaaaatagc
ttggatggttggaaaaaggtaaaggcttatgcgcagtccatcataaaaatgctcagaagc
atggggaatcagaacattataattgtaggttcgcccaattggagccagagacctgacttt
gcaattcaagaccctataaacgacaaaaatgttatgtattcagttcatttttattctggt
actcacaaggttgatgggtatgtttttgaaaacatgaaaaaggcatttgaaaatggtgtg
ccaatttttgtaagtgaatggggaacaagtttggcaagcggtgatggtggaccatatctt
gatgaggcggataagtggcttgagtatttaaatgcaaactatatcagctgggtgaactgg
tcactgtcaaacaaaaatgaaacatcagctgcttttgtcccgtatattagtggcatgcat
gatgccacatcacttgatcctggcgatgataagatgtgggatataaaagagctgagtata
tctggagagtatgttagagcaaggataaaaggagtgacatatgagccagtaagaagagat
ataggaatgaaatgcccatttaaggatgttagtgaagacaatattttttatgaacatgta
gttaagctttactccaaaggaattataaaagggacttcatcttccaagtatttgcctgat
aaaaacattacaagggctgaatttgctgcactgtgtgtcagggcattgaatctggaaata
gaaaagtatgatggaagtttttctgatgtaaaaagtgacacctggtattcggatgtggtt
tatacggcgtataaaaacggtttgtttggacaggagaaaaataggttctttcctgaaagg
attatgaaaagagaagaaacagcagctttggcaattgaagtgtacaagagattgacaggt
aaaatagaagttgacacagatgatattcaaattgccgatgaagagcttatagaccctcaa
tacagagaaagtgtgaaattagctgttcaacttggtattattgacctggtttcggatggt
acctttgcgccagataaaagtgtttcaagaggtgaggcagcaacaattatgtataacata
ttaaacctatctggtaaactgtga

DBGET integrated database retrieval system