KEGG   Caldicellulosiruptor owensensis: Calow_0531Help
Entry
Calow_0531        CDS       T01347                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calow_0531
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calow_0531
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Calow_0531
Enzymes [BR:cow01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Calow_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
611276..612766
Genome map
AA seq 496 aa AA seqDB search
MKWMRYISTRGNKEVQAKEAIYRGIAEDGGLYTPVSIPPLDLSKIKNIDSYANLAKYIFE
LYLTDFTNEEIADCIDKSYSRGKFDTKDVVAIKKLSPSLFALELWHGPTYAFKDVALQVL
PHLLLKSMPTFYKQALILVATSGDTGKAALEGFRDVDRTKIVVFYPSEGVSDVQKRQMTT
QEGRNTFVAGIKGNFDDAQSGVKEIFTDKRCIDTIENMGFFFTSANSINFGRLLPQIVYY
IWSYLVLLKNDDIREGEKINFVVPTGNFGNILAGFIAKLMGIPINKLIVASNINSVVADF
IRTGLYDRRREFYKTISPSMDILVASNLERLLYLITKDSEKVKKYMLDLKTEGYFKVEEE
VLKEIQESFWGDFSTDDQTRNSIKTIYSEYGYLVDPHSAVGFDVYSKYLKQTLDSTKTVV
LQTANPYKFAKDVLNALFDGEYNNIDPFEAVEVLQKRTCVEAPEGIKNLISKPILHPDVI
EKEKMFDFILEKIRDN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatggatgcgatatataagtacaagaggaaataaagaggtgcaggcaaaagaggcc
atttacaggggaatagctgaggatggtgggctttacacccctgtttcaattcctcctctt
gatttaagtaagataaaaaacatagactcttacgcaaatcttgcaaaatatatatttgag
ctctaccttactgattttacgaatgaagaaattgctgattgcattgacaagtcatacagc
cgtggcaagtttgacacaaaagatgttgtggctatcaaaaagctcagcccgagtcttttt
gcacttgagctgtggcatggtccgacttacgctttcaaagatgttgcattgcaggtgcta
cctcatcttttgctaaaatcaatgccaactttttacaaacaggcactcatacttgttgca
acatcaggcgatactggcaaggctgcgttggaaggatttagggatgtggatagaacaaag
atagttgtgttttatccatctgagggtgtatctgatgttcaaaaaagacagatgacaacc
caggagggcagaaacacttttgttgccgggataaaaggcaattttgacgatgcccaatcc
ggtgtgaaggagatttttacagacaaaagatgcatagatacaatcgaaaatatgggcttt
ttctttacttctgcaaactcaataaattttggtaggcttcttccacagattgtatactac
atctggagctaccttgtgcttttaaagaatgatgatattcgcgaaggtgaaaaaataaac
tttgttgttccgacaggaaattttggtaatatattggcaggctttattgcaaagctcatg
ggaatccctataaataagcttattgttgcttcgaacataaacagtgttgttgcagatttt
atcaggacaggtttgtacgacagaagaagagaattttacaaaacaatctcaccttcaatg
gacatccttgttgcaagtaatctggagaggttattgtatttgataacaaaagattcggaa
aaagtaaaaaaatacatgttagatttgaagactgaggggtatttcaaagttgaagaggaa
gttttaaaagagattcaagagagtttctggggcgatttttccacagatgaccagacaaga
aatagtataaagactatttacagcgaatatggttatcttgttgacccgcactctgctgtt
gggtttgatgtttacagcaagtacttaaagcaaaccttggatagtacaaaaacggttgtg
ctacaaactgcaaatccttacaagtttgcaaaagatgttttgaacgctttgtttgatggt
gaatataataatattgacccgtttgaagcggttgaggttttgcaaaaaaggacatgtgtt
gaagcacctgaaggaataaaaaatcttatttcaaagccaattttgcatcctgatgtgata
gaaaaagagaaaatgtttgattttatattagagaaaataagagataattga

DBGET integrated database retrieval system