KEGG   Caldicellulosiruptor owensensis: Calow_0618Help
Entry
Calow_0618        CDS       T01347                                 

Definition
udp-n-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Calow_0618
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Calow_0618
Enzymes [BR:cow01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Calow_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
711923..713410
Genome map
AA seq 495 aa AA seqDB search
MQNRKGEDFLKLKDLIENIDVLETNVGDFDKDITDIAYNSKNAKEGSAFVCIKGFKTDGH
EYIDEAIQNGARLIVVDEFFDTSKIKGKIDYIKTSNTRKALAVMSANFFAHPSKDFLLIG
VTGTNGKTSTTFMIKSILEAHGQKVGLIGTIKNMIGSKEIEAQHTTPESYDLQKLFWQMR
NEGVDSVVMEVSSHSLELFRVYASDFDVGVFTNLTQDHLDFHGTMENYFSAKLKLFGMSK
KRVINADDSWGKRIIEMYPDCMTYAKDSNATVCARNIKLYVNKNQFDLWYNDKKEEILLN
IPGLFSIYNSLAAAACCILLGIELDTIKKGLEELKAVPGRFEIVESNEKFTVVIDYAHTP
DGLLNLMRTVNEVADGRKVLLFGCGGDRDRAKRPIMGEIAGRMADFVIVTSDNPRTEDPL
KIIADILEGIKKTNVEYVVIPDRYEAIKYAIKNARENDFIVLAGKGHETYQILKDRTIPF
DEREVVKNILKELRE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatagaaagggtgaagacttcttgaaattaaaagatttaattgagaacattgat
gttttggaaactaatgttggagattttgataaagatataactgatattgcgtacaattca
aagaatgcaaaagaaggctctgcttttgtgtgtataaaaggctttaagacagatggacat
gaatatatcgatgaggcaatccaaaatggtgcacgtttgatagttgtagatgaatttttt
gatacgtctaaaattaaaggaaagattgattatatcaagacttcaaataccagaaaggca
cttgctgtaatgtctgcaaacttttttgctcatccgtcaaaagactttttgcttattggt
gtgacaggtacaaacggcaaaacttcaacaacatttatgataaaatctatacttgaagct
catggacagaaagttgggttgataggtacaatcaaaaatatgataggtagtaaagaaatt
gaggctcagcatacaactcctgagtcttatgacttgcaaaaactcttttggcagatgcga
aatgaaggtgttgacagtgttgtaatggaggtatcttcgcactctcttgagctttttaga
gtatatgcctctgattttgatgttggagtttttacaaacctgactcaagatcatttagat
tttcatggaacaatggaaaattatttttcagcaaaattgaaacttttcggtatgagcaag
aaaagagttataaatgccgacgacagttggggaaaaaggattattgagatgtatcctgac
tgtatgacatatgccaaggatagcaatgccactgtttgtgcacgaaatattaaactttat
gttaataaaaatcaatttgatctgtggtacaatgacaaaaaagaagagatattacttaat
atcccgggacttttttcaatttacaatagccttgctgctgcggcatgttgtattctactt
ggcattgaacttgatacaataaaaaaaggacttgaggaattaaaagcagtacctgggagg
tttgagatagttgagtcaaacgaaaagtttactgtggtgattgactatgcacacaccccc
gacggtcttttgaatctcatgagaacagtaaatgaagttgcagatggtagaaaggtgctg
ctttttggatgcgggggagacagggatagggcaaaaagaccaattatgggcgagattgct
ggcaggatggcagattttgtgattgttacatctgacaatccgcgaacagaagacccgctc
aagataattgctgatatcttggaaggtataaaaaagacaaatgtcgaatatgtagtcata
cccgacaggtatgaggcaattaaatatgccataaagaatgcaagagaaaatgattttatt
gttcttgccgggaaaggacatgagacttaccagattttgaaagacagaacaataccgttt
gatgagagagaagttgtgaagaatatcttaaaggagttaagagaatga

DBGET integrated database retrieval system