KEGG   Caldicellulosiruptor owensensis: Calow_0716Help
Entry
Calow_0716        CDS       T01347                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
cow  Caldicellulosiruptor owensensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cow00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calow_0716
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calow_0716
   00020 Citrate cycle (TCA cycle)
    Calow_0716
   00620 Pyruvate metabolism
    Calow_0716
   00640 Propanoate metabolism
    Calow_0716
   00650 Butanoate metabolism
    Calow_0716
  Energy metabolism
   00680 Methane metabolism
    Calow_0716
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calow_0716
Enzymes [BR:cow01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calow_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
819965..821146
Genome map
AA seq 393 aa AA seqDB search
MAIRDRLSGNEAIAFAMKQINPDVVAAFPITPSTEVPQYFSQYVANGEVDTEFVAVESEH
SAMSACIGASAAGARTMTATSSQGLALMWEMLYIAASMRLPIVMAVINRALSGPINIHND
HSDSMGARDSGWIQIYCENNQEAYDSLIQAIRIAEHKDVRLPVMVCYDGFITSHAVENIE
LLEDELVRKFVGEYNPEFYLLNEQNPVSMGPLDLPPYYFEHKRQQAEAMKNAKKVVLEIA
EEFAALTGRKYGLFEAYKLDDAEVAIVVMNSTAGTAKAVVDEYRSKGYKVGLLKPRLFRP
FPVDEIVAALKHLKAVAIMDKVDGFNAAGGPLFTEITSALYGRADGIKAVNYIYGLGGRD
VKTDDIAKVYDRLLDIVKTGNVGEVYNYIGVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctattcgtgatagactttctggtaacgaagcgatagcttttgcaatgaaacagata
aaccctgatgttgttgccgctttcccaattacaccttcaactgaggtaccacaatatttt
tctcaatatgttgcaaacggtgaagtggacaccgagtttgttgctgttgagtctgagcac
agcgcaatgagcgcatgtataggtgcgtcagcagcaggtgcaaggactatgacagcaaca
tcttcccaaggtcttgcactcatgtgggagatgctatacattgcagcgtcaatgagactt
ccaattgttatggcagttataaacagagctctttctggtcctattaacattcacaacgac
cattcagactcaatgggtgcaagagacagtggctggattcagatttactgcgaaaacaac
caggaagcttacgactctttgattcaggcaataagaattgctgaacacaaggatgtaaga
cttcctgtgatggtttgctatgacggatttattacaagccatgctgttgaaaatatagag
cttttagaagatgaactggtaaggaagtttgttggtgaatacaatccagagttttatctt
ttgaacgagcaaaacccggtttcaatgggtccgttagacttgccaccgtactactttgaa
cacaaaagacagcaggctgaagctatgaaaaatgctaaaaaggtggtacttgaaattgca
gaagagtttgctgctttgacaggaagaaagtatggtctttttgaagcatacaagcttgac
gatgcagaagttgcaatagttgtaatgaactcaacagcaggaactgcaaaggctgttgtt
gatgagtatagaagcaaaggatacaaggtaggtcttttaaaaccaagacttttcagacca
ttccctgttgatgagattgtagcagctcttaagcatttgaaggctgttgctataatggat
aaggttgatggatttaacgcagctggtggtccacttttcactgagattacaagtgctctt
tatggaagagcagatggtataaaagctgttaattatatttatggtcttggcggaagagat
gttaaaacagatgatattgcaaaggtttatgatagacttcttgacattgtcaagacaggc
aatgttggagaagtttacaactacattggtgtgagagaataa

DBGET integrated database retrieval system